Aplicaciones de los progresos de la ingeniería genética a la lucha contra las enfermedades animales*

Tamaño: px
Comenzar la demostración a partir de la página:

Download "Aplicaciones de los progresos de la ingeniería genética a la lucha contra las enfermedades animales*"


1 Rev. sci. tech. Off. int. Epiz., 1983, 2 (3), Aplicaciones de los progresos de la ingeniería genética a la lucha contra las enfermedades animales* H.L. BACHRACH**, J.J. CAIXIS**, F. BROWN*** y K. STROHMAIER** Resumen : La ingeniería genética consiste en manipulaciones del genoma de las células o de los virus, que permiten producir las sustancias deseadas (proteínas), codificadas por los genes, con miras a su uso por un organismo o un animal huésped. Engloba esta definición las recombinaciones genéticas, el clonado, la inyección o la transferencia del ADN, las fusiones celulares y la inducción o la represión de la expresión del genoma. Esta tecnología proporciona ya eficientes medios de lucha contra las enfermedades infecciosas. Dará nacimiento a una nueva generación de vacunas, a la vez inocuas, estables y de bajo precio; componiéndose ellas de proteínas de superficie (o de fragmentos de las mismas) de los agentes infecciosos, producidas artificialmente por clonado molecular o síntesis orgánica. Una de las primeras vacunas de este tipo estudiadas es una vacuna antiaftosa a base de subunidades clonadas. La administración de dos dosis de la vacuna induce la producción de anticuerpos neutralizantes en bovinos y cerdos, protegiéndolos contra el virus aftoso. Asimismo, un péptido producido por síntesis orgánica que incluye 20 ácidos ominados fue combinado a una proteína portadora; la vacuna así preparada protegió a cobayos contra el virus y produjo anticuerpos en bovinos. Las técnicas de ingeniería genética ofrecen nuevas posibilidades para el control de las enfermedades. Los anticuerpos monoclonales procedentes de la fusión de las células inmunígenas con células de mieloma permiten mejorar el diagnóstico, el tratamiento y la identificación de los agentes de las enfermedades infecciosas y tumorales. Los interferones distribuidos en las tres clases α, β У γ forman un grupo heterogéneo de proteínas que modulan algunas funciones inmu- * Ponencia presentada en la 51 Sesièn General de la O.I.E. Pars, de Mayo de 1983 (Tema tónico I). Traduccièn de la ponencia original titulada «Achievements in genetic engineering and their influence on the control and prevention of animal diseases». ** Plum Island Animal Disease Center, U.S. Department of Agriculture, Greenport, New York (Estados Unidos). *** Wellcome FMDV Laboratory, Pirbright, Surrey (Reino Unido). **** Bundesforschungsanstalt für Viruskrankheiten der Tiere, Tübingen (República Federal de Alemania).

2 678 nitarias. Recientemente, se ha producido un interferón mediante ingeniería genética a partir de E. coli en cantidades suficientes para realizar pruebas clínicas. En la actualidad, se producen todas estas sustancias y otras con los métodos de ingeniería genética. Antes de que acabe la actual década, esta tecnología permitiría producir una nueva generación de vacunas y agentes terapéuticos contra las enfermedades infecciosas, así como hormonas de crecimiento para uso en distintas especies animales. INTRODUCCIÓN La ingeniería genética es el conjunto de manipulaciones realizables a nivel de los genomas celulares o virales, a fin de obtener un producto genéticamente codificado (por ejemplo proteínas), que será utilizado por un organismo o un animal huésped para el tratamiento de enfermedades u otras anomalías en otros huéspedes. En estas manipulaciones están incluidas : las recombinaciones genéticas, el clonaje del ADN, la inyección y transferencia del ADN, las fusiones celulares y la inducción o represión de la expresión del genoma. Actualmente, esta tecnología contribuye eficazmente al control de las enfermedades infecciosas. Además, trabajos en curso de realización, tienden a introducir o reforzar ciertos caracteres favorables tanto en los animales como en los humanos. Por otra parte, una nueva generación de vacunas, diferentes de las clásicas, que se preparaban a base de los agentes etiológicos completos (virales y bacterianos), está en vía de realización. Las vacunas clásicas vivas-atenuadas o inactivadas, muestran una real eficacia contra un gran número de enfermedades, pero no están exentas de ciertas reacciones indeseables, como son las de tipo alérgico o la producción de la enfermedad con evoluciones aguda o lenta. Además, estas vacunas pueden disminuir su eficacia a la temperatura ambiente o por conservación prolongada en el frigorífico. Por último, por los procedimientos clásicos, no ha sido posible preparar vacunas contra la hepatitis tipo B, retrovirus, ni diferentes virus herpéticos. Existe una real necesidad de vacunas inocuas, estables y eficaces, de bajo costo de producción, suceptibles de prepararse en grandes volúmenes, y cubriendo un espectro de enfermedades superior al obtenido actualmente en la profilaxis, con el uso de vacunas preparadas a partir del agento completo. Afortunadamente, la nueva generación de vacunas ofrece todas estas posibilidades. Estas vacunas se preparan a partir de las proteínas de superficie (o de sus fracciones) obtenidas a partir de los agentes infecciosos y producidas artificialmente por clonaje molecular o síntesis orgánica. Ambas técnicas se utilizan para la producción de vacunas contra las enfermedades virales o bacterianas, y es previsible su aplicación en la prevención de ciertas enfermedades oncogénicas y parasitarias, tal como la tripanosomiasis humana. Una vacuna formada de subunidades clonadas contra la fiebre aftosa, ha sido la primera vacuna eficaz de esta nueva generación; su administración en

3 679 dos dosis induce la formación de anticuerpos neutralizantes y protege bovinos y porcinos contra la agresión del virus aftoso (1). Una dosis de un péptido de síntesis compuesto de veinte aminoácidos (correspondientes a las fracciones de la proteína de superficie del virus aftoso), conjugada a una proteína portadora induce la producción de anticuerpos neutralizantes y la protección del conejo y del cobayo frente al virus aftoso (2). Tres dosis de un polipéptido de 16 aminoácidos inducen la formación de anticuerpos en el conejo (3). De forma análoga, tanto la proteína de superficie del virus de la hepatitis B, producida por clonaje (4), como los fragmentos producidos por síntesis (5, 6, 7) se revelan como agentes inmunógenos. La glicoproteína D del virus del herpes simplex tipo 1, clonada sobre E. coli, induce la producción de anticuerpos neutralizantes frente a los tipos 1 y 2, lo que es un buen presagio para la futura preparación de vacunas herpéticas contra este tipo de enfermedades muy frecuentes en el hombre y animales (8). Además, el clonaje de proteínas de superficie se realiza actualmente en el caso de los virus de peste aviar (9), gripe (10, 11), estomatitis vesicular (12) y rabia (13), así como a partir de colibacilos enterotóxicos (14) y N. gonorrhoeae (15, 16). Están en vías de realización los clonajes de las proteínas de superficie del parvovirus de la gastroenteritis canina (W.E. Hahn, comunicación personal), del virus de la fiebre del Valle del Rift (U.S. Army Medical Research Command and Development Contract, 1982), arenavirus (17) y paramyxovirus (P. Choppin, comunicación personal). La actividad de las subunidades vacunantes se incrementa con los adyuvantes de la inmunidad, con las proteínas portadoras y con el sistema de presentación del antígeno (por ejemplo, presentación micelar o inclusión en liposomas). La tecnología de la ingeniería genética proporciona otros medios de control de las enfermedades además de la preparación de nuevas vacunas a base de proteínas. Los anticuerpos monoclonales, derivados de la fusión de células inmunógenas y células de mielomas, colaboran al diagnóstico, tratamiento y conocimiento de los epítopes de las enfermedades infecciosas y oncogénicas. Por otra parte, los anticuerpos monoclonales permiten de manera realista el estudio de vacunas contra las enfermedades auto-inmunes. Además, la preparación del alfa, beta y gama interferón y de sus modificaciones mediante recombinación del ADN podría resultar más económica en medicina humana y veterinaria (por ejemplo, reproductores de alto valor, caballos de carreras o animales de compañía). VACUNAS DE SUBUNIDADES Durante la década de los años setenta, fue formalmente demostrado que las proteínas aisladas de la superficie de los virus y de algunas bacterias, podían inducir la producción de anticuerpos neutralizantes y proteger los animales contra la acción de los agentes patógenos homólogos. Fragmentos pequeños de proteínas de superficie de algunos virus (por ejemplo, virus de la aftosa) muestran un verdadero poder inmunógeno (18, 19, 20). Estos hechos

4 680 coinciden con las observaciones de Atassi, que señala que los determinantes antigénicos (epítopes) de las proteínas (por ejemplo, mioglobulina y lisocima), están formados de secuencias de 6 a 7 aminoácidos de superficie, unidos de forma continua o discontinua entre los segmentos separados de la cadena proteica. La unión se realiza por pliegues terciarios y encuentran su estabilidad en los puentes de disulfuro (21). A priori, un razonamiento basado en la exigüidad de los puntos de fijación de los anticuerpos, parece indicar que el tamaño de cada epítomo es igualmente pequeño. Los resultados obtenidos con las vacunas preparadas a partir de subunidades naturales y la demostración de la pequeñez de los epítopes, han orientado el trabajo de diferentes laboratorios hacia la producción artificial de las proteínas de superficie, y de sus fracciones activas, por clonaje molecular y síntesis orgánica, así como a los controles sobre estos productos para determinar su capacidad de producir anticuerpos neutralizantes y vacunas protectoras. La síntesis orgánica de polipéptidos y proteínas, a partir de procedimientos manuales o automáticos, es una técnica bien conocida en química orgánica, en tanto que la producción de proteínas por clonaje molecular, es una técnica solamente desarrollada desde El clonaje consiste en introducir un fragmento de ADN (por ejemplo, un gene), que codifica las proteínas que se desean producir, dentro de un ADN vector a doble cadena (de) (por ejemplo, un plásmido bacteriano o un ADN viral). Este ADN se transfiere a una célula huésped (pro o eucariota), o a un animal para su multiplicación y consecutiva expresión bajo la forma de producción de la proteína deseada. Si bien la mayoría de las técnicas de clonaje se realizan de forma cotidiana en diversos laboratorios, la preparación del ADN codificado ofrece algunas dificultades. La ausencia de ADN natural para algunas proteínas, como es el caso de diversas proteínas de virus a ARN, precisa la preparación de un ADN complementario de doble cadena (ADNc dc), a partir de procesos enzimáticos, en los cuales el ARN aislado del genoma viral, a ARN mensajero (ARNm) se trata con la reverso-transcriptasa. Si el ARN es policistrónico (es decir que codifica diferentes proteínas), es conveniente determinar la secuencia de aminoácidos de la proteína deseada, para identificar la fracción correspondiente en el ADN complementario, generalmente por el método de Maxam y Gilbert. En el caso de proteínas codificadas por un ARNm monocistrónico, frecuentemente se puede preparar el ADN necesario, sin haber establecido previamente la secuencia de la proteína o de los ácidos nucleicos. En resumen, la proteína preparada que se presenta unida al ARNm (en los extractos celulares), se precipita por la acción de anticuerpos altamente específicos. El ARNm se aisla de la proteína y se transcribe como precedentemente indicado, sobre el ADNc, que a su vez será colocado en el vector apropiado. Las proteínas vacunantes, clonadas o sintéticas, presentan diversas ventajas sobre las vacunas «clásicas» : las proteínas o polipéptidos vacunantes,

5 681 no derivan directamente de partículas virales, por lo que son no-infecciosas, estables a las variaciones de temperatura, y no provocan la aparición de fenómenos secundarios, análogos a los producidos con la administración de vacunas preparadas a partir de gérmenes completos. Actualmente, el mayor inconveniente que presenta este tipo de vacunas «artificiales», es su estatuto de experimentales, siendo necesario todavía cierto tiempo antes de obtener los datos necesarios, que podrán generalizar su empleo en el campo. Las subunidades vacunantes tienen un potencial aplicativo en las enfermedades virales, bacterianas, parasitarias y oncogénicas. Sin embargo, como la mayoría de los trabajos han sido realizados contra las enfermedades virales, estas serán descritas con más detalles, en tanto que los estudios que conciernen los otros tipos de enfermedades, serán descritos ulteriormente y de modo más esquemático. VACUNAS DE SUBUNIDADES CONTRA LAS ENFERMEDADES VIRALES Dentro de las familias llamadas Viridae, se clasifican los virus que poseen una misma estructura específica, un genoma de idéntica composición, y por lo tanto, tipos y cantidad de proteínas muy semejantes en el núcleo y en la superficie. La reacción inmunológica del huésped frente a las proteínas de superficie del virus es el factor más importante del desarrollo de la inmunidad contra las enfermedades virales. El Cuadro I, modificación de Bachrach (22), reúne los virus según sus familias. La tercera columna indica las proteínas de superficie que conservan, después de separadas del virus, una o varias de sus propiedades inmunógenas siguientes : a) reacción con los anticuerpos virales neutralizantes o precipitantes, b) inducción a producir anticuerpos neutralizantes o precipitantes, c) protección de los animales contra una prueba virulenta. Las columnas 4 y 5 indican el estado actual de la producción de estos inmunógenos, o de sus fragmentos activos, por clonaje o síntesis orgánica. Como varios centenares de virus animales han sido identificados, no pueden incluirse todos en el cuadro. Sin embargo, resalta un principio importante, que es el siguiente : una vez realizados el aislamiento, el clonaje o la síntesis de los inmunógenos de superficie para un miembro de una familia de virus, las mismas técnicas deberían poder aplicarse frente a los otros miembros de la familia. Por lo tanto, estudiaremos el cuadro sobre todo en lo que se refiere a los miembros de una familia, cuyos inmunógenos proteicos han permitido realizar los progresos más notables. Las vacunas de subunidades contra los virus papova, adenovirus y herpes virus serán examinadas conjuntamente, por tener semejantes modos de replicación y capacidad de su ADN de aislado para provocar la infección. En lo que se refiere a los papovavirus, se ha publicado la noticia de que el clonaje

6 682 CUADRO I Elementos posibles de vacunas a subunidades contra las enfermedades virales Inmunógenos Familia Virus Parte viral aislada Clonaje Síntesis 00 &Z GO ND n PH PM Lininas Ö Z oo T (amplio tumor) Fibras de pentone y hexone Dos proteínas de la membran; del virus del herpes del paví Glicoproteína Glicoproteínas Glicoproteínas gc y gd Antígenos solubles y hemaglul de virus extra- e intracelulai Antígenos solubles Proteínas capsulares Proteínas capsulares Papiloma humano (verrugas) Simio 40 Adenovirus Enfermedad de Marek Papovaviridae Adenoviridae Herpetoviridae IBR Enfermedad de Aujeszky Herpes simplex Viruela del conejo Orthopoxviridae Q Z oo Û.OÛ z&zz Sí GN a 1, (j 3 et λ2 (proteínas) Proteína p2 Proteína p26 y glicoproteína gp34 VP7.2 Proteína de superficie VP] de 24 kd** VP, Proteína p61 Vacuna H-l Parvovirus canino Reovirus Lengua azul Simio II Ternera Fiebre aftosa Poliovirus Exantema vesicular Parvoviridae Reoviridae Orbiviridae Rotaviridae Picornaviridae QQ ZZ Virus degradado E]_ 3 Glicoproteína V3 QQ ZZ Virus degradado E1-2 Virus degradado E1-2 Semliki Forest Encefalitis por garrapatas Peste porcina clásica y diarrea bovina Rubéola Caliciviridae Togaviridae Alphavirus Flavivirus Pestivirus Rubivirus

7 683 CUADRO I (cont.) Inmunógenos Familia Virus Parte viral aislada Clonaje Síntesis 53 QQ ZZ Glicoproteína Glicoproteína (190 kd) IS] Gastro-enteritis transmi porcina Humanos Coronaviridae Virus degradado, hemaglutinina Hemaglutinina cu Pu Pu Glicoproteínas Gj.2 S ND Sí Sí Q Q Q ZZZ 155 CD Glicoproteínas Hemaglutinina, neuraminidase Proteína F Hemaglutinina y proteína F/ hemolisina Glicoproteína G Glicoproteína G Glicoproteína gp71 Antígeno celular tumoral solubl m Gripe Peste aviar Recombinantes y fiebre del Valle del ï Coriomeningitis linfocii y otros Sendai, Newcastle Simio 5, parainfluenza- Sarampión Orthomyxoviridae Bunyaviridae Arenaviridae P aramyxovirídae Antígeno de superficie de la hepatitis B Estomatitis vesicular Rabia Friend Leucemia felina Leucemia de Maloney Hepatitis B Rhabdoviridae Retroviridae No clasificado * Modificado según artículo 22 de la bibliografía. Las vacunas a virus degradado de la gripe y a antígeno de superficie de la hepatitis B están en uso. ND = no determinado a nuestro conocimiento. IP = investigación en progreso. Entre los inmunógenos clonados, solamente ha sido descrito como protector de la infección experimental de prueba la proteína de superficie de 24 kd del virus de la fiebre aftosa. ** Llamado VP 3 ó VPT por otros autores.

8 684 del ADN del virus de las verrugas humanas está en vías de investigación, con el objetivo de la posible elaboración de una vacuna (Universidad de Minnesota, 1981); a partir del virus de simio 40, se han sintetizado dos polipéptidos que poseen parcialmente el poder inmunógeno del voluminoso antígeno tumoral codificado por el virus (23). Por lo que se refiere a los adenovirus, se ha relatado que las fibras de hexones y pentones suscitaban la formación de anticuerpos neutralizantes (24), y una colección de fragmentos de ADN de adenovirus ha sido elaborada por clonaje molecular y corte por medio de la endonucleasa de restricción (H.S. Ginsberg, comunicación personal). Con todo, no hemos todavía leído publicaciones relatando la expresión de una u otra de estas proteínas de superficie. En el caso de los virus herpes, se ha relatado que el pollo queda protegido contra la enfermedad de Marek después de dos inyecciones de dos proteínas de la membrana citoplásmica de células infectadas por el virus herpes del pavo (25), y que una vacuna experimental a base de subunidades, elaborada con virus de la rinotraqueitis infecciosa bovina (IBR), protege a los animales contra la infección experimental del virus (26). Una glicoproteína purificada, extraída del virus IBR, suscita la producción de anticuerpos neutralizantes en el conejo y los bovinos (D. Reed, comunicación personal). Asimismo, dos vacunaciones por medio de una glicoproteína del virus de la enfermedad de Aujeszky han suscitado la formación de anticuerpos neutralizantes y protegido al cerdo contra una prueba intranasal (K.B. Platt, comunicación personal). A pesar de ello, el progreso más importante relativo a las vacunas de subunidades virales para los virus herpes, se ha conseguido con el virus herpes simplex 1 (HSV-1) (8). Después de aparecer una publicación demostrando que las glicoproteínas gc y gd del virus herpes inducían la aparición de anticuerpos neutralizantes (27), el ADN del HSV-1 específico de esta última sustancia ha sido clonado dentro de E. coli, motivando la expresión de un polipéptido emparentado con la glicoproteína gd y reproduciendo anticuerpos neutralizantes para los dos virus HSV-1 y HSV-2 (8). Este trabajo es importante, no sólo para una posible elaboración de vacunas a base de proteínas contra el herpes venéreo, sino también para la elaboración de vacunas análogas contra las numerosas enfermedades causadas por los virus herpes en el hombre y en los animales. En los orthopoxvirus, los principales antígenos de superficie ascienden a cinco (28). Se ha relatado que los antígenos solubles intracelulares obtenidos de los virus pox del conejo y del virus de la vacuna, suscitaban la aparición de anticuerpos neutralizantes frente a virus homólogos, pero no frente a virus extracelulares (29, 30). Parece que las reacciones inmunológicas, frente a la hemaglutinina tardía de la envoltura de los virus extracelulares y frente a la membrana de las células infectadas, fueran muy importantes dentro del proceso de protección. A pesar de que ninguna vacuna de subunidades útil contra los virus orthopox haya sido descrita, el virus de la vacuna puede ser útil en ingeniería biológica como vector de clonaje y de expresión para la transferencia de genes extranjeros en los eucariotes, e incluso en los animales (31).

9 685 Así, las células infectadas por el virus de la vacuna y un plasmido que contiene el gene de la timidinakinasa del virus herpes, producen un virus recombinante de la vacuna, que permite a las células la producción de la misma timidinakinasa. Resultados similares han sido conseguidos con virus recombinantes de la vacuna programados con genes codificadores de las proteínas de superficie de otros virus animales no emparentados, especialmente el virus de la hepatitis B (B. Moss, comunicación personal). Por consiguiente, el aparente éxito de la erradicación de la viruela con el virus de la vacuna deja entrever la posibilidad del empleo de sus recombinantes como vacunas vivas, para la profilaxia de otras enfermedades humanas y animales de gran importancia. Los parvovirus abarcan un grupo de virus que contienen genomas de ADN monocatenario, positivo o negativo, dentro de capsidos diferentes. Las proteínas de superficie aisladas, tanto del parvovirus del perro como del parvovirus de la rata (H-l), suscitan la aparición de anticuerpos neutralizantes en el cobayo (Rhode III S, comunicación personal). En fin, la proteína de superficie del parvovirus del perro ha sido clonada y utilizada para suscitar la producción de anticuerpos neutralizantes en el ratón (W.E. Hahn, comunicación personal). Por ser muy acusadas sus semejanzas estructurales y funcionales, se pueden examinar juntos los progresos realizados en las vacunas de subunidades relativas a los Reoviridae, Orbiviridae y Rotaviridae. Estas semejanzas son tan grandes que estos virus podrían ser facilmente clasificados dentro de una sola familia con las necesarias subdivisiones. En lo que se refiere a los reovirus, se ha publicado que la proteína de superficie σ1 suscitaba la formación de anticuerpos neutralizantes, y que las proteínas a 3 y λ2 de varios serotipos también poseían esta actividad (32). A pesar de que la mayor parte de la proteína A 2 se halla sobre el «núcleo» viral, un segmento de ésta se estira a través de él hasta la superficie del virus. En los orbivirus, una proteína llamada p2 podría llegar a ser una vacuna de subunidad por el motivo siguiente : existe una gran correlación entre la dosis de anticuerpos precipitando la proteína p2 y las dosis de anticuerpos neutralizantes en los antisueros frente al virus de la lengua azul (33), lo que se confirma por el hecho de que el anticuerpo monoclonal específico de p2 inmuniza pasivamente el carnero (34). Por lo que se refiere a los rotavirus, la proteína no reducida p26 y la glicoproteina gp34 aisladas del virus de simio SA II inducen anticuerpos neutralizantes específicos del tipo (35). Cuando se emplean antisueros policlonales monoespecíficos se ha comprobado que el determinante antigénico mayor, específico de la neutralización del rotavirus del ternero, parecía estar presente dentro de una pequeña proteína VP 7.2 de la capa externa del virus (36). Cuatro familias (Picornaviridae, Caliciviridae, Togaviridae y Coronaviridae) se diferencian notablemente por su estructura viral, la estrategia de réplica de sus genomas y la composición de sus proteínas. Los virus contienen

10 686 un genoma infeccioso de ARN monocatenario y han contribuido al progreso de la puesta a punto de las vacunas de subunidades. En lo que se refiere al virus aftoso, miembro de la familia de los Picornaviridae, dos vacunaciones por medio de una proteína de superficie de 24 kilodaltones (kd) aislada de virus de tipos O y A, han inducido la formación de dosis elevadas de anticuerpos neutralizantes en el cerdo (37, 38). Estos han protegido a los cerdos y a los bovinos contra una prueba con el virus homólogo (38) (en electroforesis en gel de poliacrilamida, esta proteína migra como VP 3 en concentración fuerte de urea, y como VP 1 en concentración débil; se la califica también de VPT, pues la treonina es su aminoácido N terminal). Los péptidos conseguidos por segmentación de la proteína de superficie del virus de tipo O inducen la formación de anticuerpos neutralizantes en el cobayo y le garantizan una protección parcial contra la generalización de las lesiones primarias, cuando se los somete a una infección viral de prueba (18). Un fragmento de 13 kd, obtenido con bromuro de cianuro, conteniendo los aminoácidos 55 a 179 de la proteína de superficie del virus aftoso de tipo A, protege tanto a los cerdos como a los bovinos contra una prueba virulenta con el virus homólogo (19, 20). Idénticos resultados se han conseguido, por medio de dos vacunaciones con la proteína recombinante de superficie de tipo A, producida por E. coli (1). Administrada en vacunación doble, esta proteína induce la síntesis de anticuerpos neutralizantes y protege por lo tanto porcinos y bovinos. Además, de tres cabras inoculadas repetidamente con una proteína de superficie recombinante de tipo O, dos han producido anticuerpos neutralizantes, y después de prueba virulenta, presentaron una viremia muy leve o nula y temperaturas inferiores a las de las cabras testigos (39). Una dosis de un péptido sintético con 20 aminoácidos de amplitud correspondiente a los aminoácidos 141 a 160 de la misma proteína de superficie, conjugada con una proteína portadora, ha inducido la formación de dosis elevadas de anticuerpos neutralizantes en los conejos y ha protegido a estos animales contra una inoculación de prueba empleando el virus aftoso (2). El péptido sintético de 20 aminoácidos correspondiente a las proteínas de superficie de dos sub-tipos A, ha inducido igualmente la formación de anticuerpos neutralizantes en el conejo (2). Además, tres dosis de un péptido de 16 aminoácidos de tipo O (fracciones 144 a 159) administradas con una proteína portadora han inducido la formación de anticuerpos neutralizantes en el conejo (3). Estos resultados conseguidos con el conejo indican que los péptidos de síntesis podrían proteger a las especies sensibles a la fiebre aftosa como los bovinos y el cerdo. Es muy optimista la conclusión de un artículo que resume una discusión reciente acerca de la posibilidad de desarrollo práctico de vacunas contra la fiebre aftosa a base de proteínas de recombinación o de síntesis (40). Si se excluyen los virus aftoso y Coxsackie (41), las proteínas de superficie aisladas dentro de los otros Picornaviridae no revisten una actividad inmuno-

11 687 gena. Sin embargo, dos artículos se han publicado hace poco tiempo, que demuestran de manera cierta dicha actividad de la VP 1 aislada de poliovirus (42, 43). La variabilidad de las secuencias de aminoácidos caracteriza las variantes de las proteínas de superficie inmunógenas en los virus aftosos. Sería interesante establecer una correlación entre esta variabilidad, las actividades biológicas (serotipos, inmunotipos, virulencia, poder patógeno, especificidad de los receptores celulares) y la evolución de los tipos y sub-tipos virales. La Figura 1 indica las secuencias para ocho sub-tipos de virus A, O y C. Parecería que la hipervariabilidad de las secuencias en la región esté en correlación con la actividad inmunógena, registrada en el conejo, de péptidos sintéticos que corresponden a dicha región (2, 3). También se observa una variabilidad importante en la región 43-60, pero hasta el momento una sola forma de actividad es atribuida a dicho dominio. Su actividad se sitúa en el tercio derecho de la región que pertenece al fragmento de 13 kd obtenido a partir del bromuro de cianuro con la proteína de superficie del virus A n, que protege el ganado contra la prueba de infección viral (19, 20). En la proteína de superficie de tipo O,, las secuencias de las dos variantes son muy estables : sólo difieren por tres substituciones, dos de las cuales se sitúan en las regiones variables descritas precedentemente. Parecería que las secuencias de los tipos 0 y C están más estrechamente ligadas entre ellas que con las secuencias del tipo A. Se prosiguen las investigaciones para poder establecer una cartografía del número y de las especifidades de los determinantes antigénicos sobre estas proteínas, utilizando anticuerpos poli o monoclonales, péptidos sintéticos inmunógenos, determinaciones de estructura tridimensional y las técnicas correspondientes. Sería prematuro el especular sobre las posibilidades de una correlación entre el epítope y la actividad. La prueba experimental será indispensable, sobre todo por el hecho de que la substitución de un solo aminoácido puede modificar notoriamente la estructura y la actividad de una proteína. El ejemplo clásico está dado por la cadena S de la hemoglobina en la anemia falciforme. En lo que se refiere a los calicivirus, sólo podría ser retenida como vacuna de subunidades la proteína mayor del virus del exantema vesiculoso del cerdo. Dos vacunaciones con esta proteína parecen suscitar la formación de anticuerpos neutralizantes en el cerdo (A.H. Dardiri y H.L. Bachrach, observaciones no publicadas). Los togavirus poseen también una proteína de superficie que posiblemente podría ser apta para la elaboración de una vacuna de subunidades. Dentro del género Alfa, se consigue una buena protección contra el virus Semliki Forest cuando la glicoproteína se presenta bajo forma de un polímero miceliano (44). Dentro del género Flavi, complejos de polímeros de la glicoproteína V 3, aislada del virus de la encefalitis transmitida por las garrapatas, inducen la formación de anticuerpos neutralizantes e inhibidores de la hemaglutinación. Comparados con vacunas de agentes enteros, estos complejos resultaron diez

12 A 5 Ww TTAVGESADPVTTTVENYGGDTqTQRRYYMDVGFIMDRFVKINSLSPTHVIDLMQTHQHGLVGALLRAAT TT V HHT K I AT E V HHT s K N 24 Cruz XXXXXXXXXXX E I HHT I Q T 0 1 BFS SA E I QHT S VTPQNQINIL VPS T S 1 K SA E I QHT S VTPQNQINIL IPS T S C 1 Obb TT E V HHT A VL VTVSGNQ TL V A KDNI 3 Inda TT E I HHT A VL VHVSGNQ TL V V K SI A 5 Ww YYFSDLEIVVRHDGNLTWVPNGAPEAALSNTSNPTAYNKVPFTRLALPYTAPHRVLATVYNGTNKYS T A D A G A A 24 Cruz E s L A P S A V 0 1 BFS A K ERD K D T H A L ECR RNA 1 K A K E D K D T H A L ECR NRNA C 1 Obb A T T K VS D T H G L T TT T A 3 Inda A T T K VS D A H G L T T TA T A A 5 Ww GGP--RRGDMGSAAARAAKQLPASFNYGAIRAITIHELLVRMKRAELYCPRPLLAIEVSSQDRHKQKIIAPARQLL SDS S L I V T Q QA K T Y K S S-GV F L P V R K E GK - 24 Cruz S-G L VV K DA K 0 1 BFS VPNL- - LQVL QKV RT T K TRVT Y T HPT-EA V VK T 1 K VPNL- - LQVL QKV RT T K TRVT Y T HPT-EA V VK T C 1 Obb S-T LAHLT TR GH T F VK E T T I P QPT-G PLV K 3 Inda S-A LAHL AH RH T F VK E T T V PVQPT-G PL FIGURA 1 Secuencias de ácidos aminados en ocho variantes de proteínas de superficie inmunógenas de 24 kd extraídas de virus aftosos A, O y C. Se establecieron las secuencias a partir de las secuencias de nucleótidos determinadas por los correspondientes ADN complementarios (1, 85, 86, 88, 89). Unicamente se especifican las diferencias con relación a la secuencia de A 5 Ww. Los guiones corresponden a las deleciones hechas para representar adecuadamente las alineaciones de las secuencias. Los residuos de ácidos aminados en las variantes proteicas son en número de : 209 en C1 Obb; 210 en C 3 Indaial; 212 en A 5 Ww, A y A ] 2 119; 213 en A 2 4 Cruzeiro, O, BFS y O1 Kaufbeuren. Todas las variantes poseen treonina (T) en N terminal y leucina (L) en C terminal. Las demás abreviaturas son : A, alanina; C, cisteína; D, ácido aspártico; E, ácido glutámico; F, fenilalanina; G, glicina; H, histidina; I, isoleucina; K, lisina; M, metionina; N, asparagina; P, prolina; Q, glutamina; R, arginina; S, serina; V, valina; W, triptófano; Y, tirosina; X, sin indicar.

13 689 veces más activos en las pruebas de radioinmunología y ofrecen una protección idéntica a los ratones contra una prueba virulenta (45). Dentro del género Pesti, vacunaciones repetidas con las glicoproteínas supuestas ser El y E2, elaboradas mediante degradación por los detergentes del virus de la peste porcina clásica (PPC) o de células infectadas, han inducido la formación de anticuerpos neutralizantes y han protegido a los cerdos contra el virus de la PPC (46). El virus de la diarrea bovina (equivalente para los bovinos del virus de la PPC), degradado por los detergentes, ha resultado tener una actividad menor como la vacuna de subunidades contra la PPC que las glicoproteínas correspondientes. Dentro del género Rubí, los resultados conseguidos con el virus de la rubéola, degradado por los detergentes (47), parecen ofrecer como vacunas de subunidades, esperanzas mayores que los de las rosetas de hemaglutinina o de las preparaciones de virosoma (48). Los coronavirus, que son los virus que tienen la cadena de ARN positivo más larga (unos nucleótidos), poseen también proteínas de superficie aptas para la elaboración de vacunas de subunidades. El uso de los antisueros específicos para cada una de las tres proteínas del coronavirus humano demuestra que la proteína que migra más lentamente (13 kd), induce la formación de anticuerpos neutralizantes contra una cepa de virus y, a la vez, neutralizantes e inhibidores de la hemaglutinación contra otra cepa (49). Dos vacunaciones con las glicoproteínas aisladas del virus de la gastroenteritis transmisible inducen la formación de anticuerpos neutralizantes y protegen a los cerditos recién nacidos contra una exposición al virus, directa o por contacto (P. Gough, comunicación personal). Los virus que poseen un genoma de ARN negativo segmentado (Orthoviridae, Bunyaviridae y Arenaviridae), tienen glicoproteínas de superficie aptas para la elaboración de vacunas de subunidades. Por ejemplo, una vacuna comercializada contra la gripe, a base de virus degradado, suscita una seroconversión y provoca menos efectos secundarios que las vacunas a base de agente entero, pero dos dosis son necesarias para los sujetos primovacunados (50). El gene del inmunógeno principal de superficie (hemaglutinina, HA) del virus de la peste aviar ha sido clonado y exprimido en E. coli (9) y el gene del virus patógeno de la gripe humana lo ha sido igualmente en cultivos de células eucariotes (51) y en E. coli (10, 11). Se ha constatado que cada célula produce 10 8 moléculas de HA, que absorben específicamente las hematías y los anticuerpos virales. El empleo del gene de un mutante sin lugar antigénico de la HA permite expresarse y secretarse eficazmente en el líquido extracelular a la HA clonada (52). Las moléculas de HA clonadas parecen ser susceptibles de ser empleadas como vacuna de subunidades. Sin embargo, de los 20 péptidos parcialmente idénticos sintetizados frente a 75 por ciento de la porción HA1 de la molécula natural, ninguno reacciona con los anticuerpos del auténtico HA1 (53). Se ha comprobado que los péptidos sintéticos correspondientes a los 11 aminoácidos del N terminal de la zona de fusión celular de la parte HA2 de la

14 690 HA de los virus gripales A y B, fijan los anticuerpos humanos y los anticuerpos monoclonales anti-ha (54). Aunque los anticuerpos antipéptidos fijen la HA y el virus homólogo, no consiguen neutralizar la actividad viral. Por consiguiente, son necesarias investigaciones suplementarias para la elaboración de vacunas a base de proteínas de síntesis o de clonaje contra el virus gripal, comprendiendo eventualmente la neuraminidasis (NA) de la envoltura viral. Una vacuna de subunidades que contiene los dos elementos del virus de la gripe, la HA y la NA, ha mostrado grandes posibilidades en los experimentos sobre ratones (55). Los principales inmunógenos de los Bunyaviridae son dos glicoproteínas G1 y G2 codificadas por un fragmento de talla mediana del ARN viral (56). El clonaje y la expresión de estos dos elementos están en trámites para el virus de la fiebre del Valle del Rift, y pueden desembocar en la creación de una vacuna de subunidades utilizable en la profilaxia de esta peligrosa zoonosis. Los arenavirus contienen también una o dos glicoproteínas de superficie; y a pesar de que no hayan sido enteramente caracterizadas en lo que se refiere a su actividad inmunógena (57), se considera que la glicoproteína pgp-c codificada por el pequeño ARN del virus Pichinde, es una candidata para la preparación de una vacuna de subunidades que merece ser codificada (17). Las glicoproteínas de superficie de los virus con ARN no helicoidal y no segmentado (Paramyxoviridae y Rhabdoviridae) han sido estudiadas igualmente en lo que se trata de sus poderes inmunogénicos. Los paramixovirus tienen dos glicoproteínas de superficie, una de ellas tiene una actividad hemaglutinante (H) o hemaglutinina y neuroaminidasa (HN) y la otra tiene actividades de fusión celular o de hemólisis (proteína F). La proteína H aislada del virus del sarampión (58) y las proteínas HN aisladas de los virus Sendaí, Newcastle, simio 5 y parainfluenza-3, suscitan la producción de anticuerpos neutralizantes (59, 60). La proteína F induce la producción de anticuerpos que se oponen a la replicación viral (59). Se están realizando investigaciones en varios laboratorios para lograr el clonaje de las proteínas H, HN y F y de las proteínas de la matriz de los paramixovirus (61; P. Choppin, comunicación personal). Los rabdovirus poseen una glicoproteína G, inmunógena (hemaglutinina). Las subunidades del virus rábico o la glicoproteína G aislada suscitan la producción de anticuerpos neutralizantes e inmunizan a los animales (62). Los genes de la glicoproteína G de los virus de la rabia (13) y de la estomatitis vesicular (12) han sido clonados en E. coli. El producto del clonaje del gene G de la estomatitis vesicular es precipitado por los anticuerpos dirigidos contra el virus, lo que indica que contiene determinantes antigénicos G. Una forma de la proteína G del virus de la estomatitis vesicular sin sitio de fijación está secretada lentamente por las células eucariotes (63). Se espera que estas proteínas clonadas serán inmunógenos útiles en particular contra la rabia, ya que las vacunas contra la rabia a base de agente entero pueden provocar reacciones neurológicas graves. Los retrovirus (virus con ARN, cuya replicación se hace por medio de un ADN recombinante), poseen glicoproteínas de envoltura que tienen actividad

15 691 inmunógena. La glicoproteína gp71 aislada del virus Friend de la leucemia murina inmuniza a los ratones contra la prueba virulenta (64). Una vacuna conteniendo subunidades del virus de la leucemia felina y antigenes solubles de las células tumorales protege aproximadamente un 80% en la prueba virulenta (65). Resultados semejantes conseguidos contra las enfermedades por retrovirus tales como la leucosis bovina, la anemia infecciosa equina y la leucemia-linfoma de células T del hombre, representarían una etapa decisiva en la prevención del cáncer. Los antígenos sintéticos también podrían ser empleados, ya que se ha demostrado que un pentadecapéptido, codificador de una secuencia de nucleótidos en el extremo 3' del ADN del virus de la leucemia de Maloney, suscitaba la producción de anticuerpos opuestos a las proteínas de la envoltura del virus (66). Se ha demostrado que el antígeno de superficie (HBsAg) del virus de la hepatitis B (virus sin clasificar todavía) protege a los chimpancés contra una prueba virulenta (67). Este antígeno aislado del suero humano se emplea actualmente como vacuna para el hombre (68). Esto parece demostrar la existencia de anticuerpos neutralizantes cruzados contra todos los virus de la hepatitis B que poseen el antígeno de superficie a (69). El gene de HBsAg ha sido clonado en varios laboratorios y sus productos parecen fijar los anticuerpos dirigidos contra el HBsAg auténtico (4). El clonaje sobre una levadura produce partículas de HBsAg de 22 nm análogas a la verdadera estructura del auténtico HBsAg (W.J. Rutter, informe del Congreso Internacional de Virología, 1981). Además, un péptido hidrófilo de síntesis imitando los fragmentos 138 a 149 del HBsAg reacciona con los anticuerpos auténticos (5), y otros péptidos de síntesis correspondientes a esta región o a otras regiones del HBsAg inducen la formación de anticuerpos que reaccionan con la proteína propia de la envoltura del virus (6, 7). VACUNAS DE SUBUNIDADES PARA LAS ENFERMEDADES BACTERIANAS La ingeniería genética se ha aplicado con igual éxito a la elaboración de vacunas a base de proteínas contra las enfermedades bacterianas. Gran parte de las primeras investigaciones se han concentrado en los pili somáticos de los E. coli enterotóxicos (ECET) que provocan diarreas en los recién nacidos humanos y animales. Los pili somáticos de los E. coli enterotóxicos son apéndices no flagelares, compuestos por moléculas de proteínas de 14 a 22 kd, llamadas pilinas, que facilitan la adhesión a la mucosa del intestino delgado y la colonización del mismo (70). Cepas de pili distintas inmunológicamente han sido aisladas de diferentes ECET : K88 y 897P en el cerdo, K99 en los bovinos, ovinos y porcinos, CFA 1 y 2 en el hombre, tipo 1 y otros pili comunes. Pili aislados han sido empleados como vacunas contra las diarreas provocadas por los ECET en los animales y el hombre. Ciertos genes de las pilinas son codificados sobre cromosomas (tipo 1 y probablemente 897P) y otros sobre plasmidos (K88, K99, CFA 1 y 2) (70). Se ha realizado la producción por +clonaje de ciertos de los pili codificados por plasmidos y sería posible disponer de una vacuna clonada en varios países europeos (14).

16 692 Se ha fabricado una vacuna idéntica a base de pili para ser empleada en el hombre contra cepas de Neisseria gonorrhoeae resistentes a la penicilina (15, 16). Se ha elaborado un vector plasmídico que contiene el fragmento de ADN del gonococo codificador de los pili, y dicho vector se empleó para mutar a los E. coli. Los colibacilos así reprogramados han sido identificados por anticuerpos monoclonales específicos de los pili, lo que indica la expresión de la proteína portadora de los epitopes de pili del gonococo. Investigaciones más profundas podrían conducir a la preparación, por ingeniería genética, de una vacuna de subunidades eficaz contra la gonorrea. PERSPECTIVAS FUTURAS DE LAS VACUNAS DE SUBUNIDADES FRENTE A LAS ENFERMEDADES PARASITARIAS No siendo los autores del presente artículo especialistas de las enfermedades parasitarias, se limitarán a una breve evocación de la extensión de los principios de la ingeniería genética a la lucha contra las enfermedades parasitarias, tomando como ejemplo Trypanosoma rhodesiense (71). Las personas afectadas por este parásito contraen la enfermedad del sueño. Los anticuerpos protectores que son producidos reaccionan con la glicoproteína de superficie del parásito destruyendo éstos en su casi totalidad. Sin embargo, aparecen parásitos resistentes que presentan modificaciones de una u otra de las 20 (o más) glicoproteínas de superficie codificadas y exprimidas por T. rhodesiense. Este proceso de inmunidad y de reinfestación se produce varias veces hasta que muere el huésped. La perspectiva de tener que emprender la clonación de las numerosas variantes de las glicoproteínas de superficie de T. rhodesiense representa una tarea temible pero no imposible, tarea que sin embargo posiblemente se emprenderá después de las investigaciones relativas a agentes cuyas proteínas de superficie son menos complejas. Entretanto el reciente descubrimiento de dos tipos de anticuerpos dirigidos contra las regiones fosfolipídicas de la membrana de T. rhodesiense, anticuerpos más estables, abre una vía nueva en la investigación, y propone explicación de la curación espontánea de conejos experimentalmente infestados. ANTICUERPOS MONOCLONALES La técnica de los anticuerpos monoclonales, forma de ingeniería genética, inicia una total transformación de la investigación, los métodos de diagnóstico y el tratamiento relativos a las enfermedades humanas y animales. Los anticuerpos monoclonales, como las técnicas de recombinación del ADN, son un descubrimiento reciente que se publicó por primera vez en 1975 por Kohler y Milstein (72) con un título revelador : «Cultivos continuos de células fusionadas, productoras de anticuerpos con especificidad predeterminada». Estos anticuerpos son conocidos con el nombre de anticuerpos monoclonales, pues constituyen una población homogénea de moléculas idénticas. Son elaborados por un hibridoma que resulta de la fusión de célu-

17 693 las productoras de anticuerpos y de células neoplásicas de mieloma. La obtención de un hibridoma exige largos y difíciles trabajos de laboratorio, pero, una vez obtenido el hibridoma, teóricamente puede producir, por perpetuas replicaciones, un anticuerpo homogéneo en cantidades que van de 100/ug/ml de líquido de cultivo, hasta 10 mg/ml de líquido de ascitis de ratón portador de hibridoma (73). Los hibridomas pueden ser congelados en nitrógeno líquido, lo que permite volver a ponerlos en cultivo más tarde. Los anticuerpos monoclonales son más específicos que los anticuerpos policlonales, pero sufren ciertas limitaciones. No siempre son capaces de producir la red necesaria para precipitar el antígeno, y ciertos anticuerpos monoclonales no fijan el complemento. Tampoco son muy útiles para la detección sistemática de una enfermedad, ya que su gran especificidad no les permite reconocer más que una sola variante o un serotipo particular de un agente patógeno. No obstante, los anticuerpos monoclonales no son estrictamente monoespecíficos, porque se pueden fijar con gran avidez sobre ciertos antígenos celulares o virales que presentan analogías estructurales con el epítope homólogo. Con todo, resultan mucho mayores las ventajas de los anticuerpos monoclonales que sus pocas limitaciones. Las aplicaciones de los anticuerpos monoclonales ya son muy numerosas en el campo de la investigación y de la profilaxia de las enfermedades animales y humanas. Estas aplicaciones comprenden : a) la purificación de los antígenos; b) la aclaración de las complejidades de la red inmunitaria; c) el análisis de la composición de los epítopes de antígenos que van desde simples moléculas de proteína hasta organismos complejos; d) el diagnóstico de las enfermedades; e) el tratamiento de las enfermedades; f) una contribución a los progresos de la elaboración de vacunas antiidiotipo. Solamente son presentados a continuación unos pocos ejemplos de aplicación de los anticuerpos monoclonales. Acoplados de modo covalente en columnas de gel de afinidad, los anticuerpos monoclonales son útiles por tener capacidad de aislar antígenos puros de mezclas complejas, tales como los valiosos productos preparados por organismos manipulados genéticamente (74). Dentro de esta aplicación, los hibridomas y las técnicas de recombinación del ADN se articulan hasta llegar a ser altamente complementarios. En lo que se refiere a la complejidad de la red inmunitaria, los anticuerpos monoclonales revelan diferencias en las poblaciones de células T y llegan a caracterizar los complejos mayores de antígenos de histocompatibilidad, con una precisión mayor que la de los anticuerpos policlonales. Se han empleado eficazmente los anticuerpos monoclonales en virología con el fin de establecer los mapas antigénicos de las proteínas de superficie y

18 694 las localizaciones de los determinantes antigénicos implicados en las mutaciones fenotipicamente identificables. Los virus estudiados por medio de los anticuerpos monoclonales comprenden los de la gripe, del herpes, de la rabia, los adenovirus, los virus del tumor mamario del ratón, de la poliomielitis, de la fiebre aftosa, de la rubéola, de la gastroenteritis por parvovirus del perro, de la panleucopenia felina, y de la lengua azul. Además de sus potencialidades diagnósticas, los anticuerpos monoclonales son útiles para identificar los epitopes que contribuyen a la aparición de la reacción inmunitaria protectora; así, pues, son importantes para la elaboración de vacunas eficaces por síntesis o por clonaje. También son útiles para identificar los sitios patógenos de los virus (75). Así, si se considera que en un cultivo de tejidos, en el que se multiplica el virus rábico fijo (patógeno para el ratón), en presencia de anticuerpos monoclonales antiglicoproteicos, hay una selección de variantes virales no patógenas, en las que la isoleucina o la glutamina ocupase la plaza 333 de la glicoproteína de superficie en vez de presentar la habitual arginina, podemos llegar a la conclusión de que esta arginina, en dicha posición, es imprescindible para que el virus manifieste su poder patógeno en el ratón. El análisis antigénico de los parásitos con los anticuerpos monoclonales es particularmente importante por ser muy numerosos los epitopes implicados, y por ser éstos variables durante los ciclos evolutivos, en los que se oponen a las defensas inmunitarias. Se han producido anticuerpos monoclonales contra varios parásitos, entre los cuales los de la tripanosomiasis, Theileria parva (fiebre de la Costa Este), y Plasmodium berghei (76). Se ha demostrado que los anticuerpos monoclonales inhiben una fase del desarrollo de Trypanosoma cruzi, agente de la enfermedad de Chagas (77). Por el contenido elevado, en particular en el líquido ascítico, los anticuerpos monoclonales son empleados en inmunoterapia pasiva. Se ha sugerido que la fiebre del transporte («shipping fever») de los bovinos podría ser combatida por administración de anticuerpos monoclonales dirigidos contra el virus parainfluenza-3 (76). Los anticuerpos monoclonales abren muchas esperanzas para el diagnóstico precoz y el tratamiento de las enfermedades tumorales. Los estudios experimentales y los ensayos clínicos sugieren la posibilidad de provocar la fijación de anticuerpos monoclonales sobre los antígenos tumorales específicos de las células, con fijación nula o leve sobre los antígenos celulares normales (8). Los anticuerpos monoclonales también pueden transportar así radioelementos hasta las células tumorales con el fin de establecer el diagnóstico o transportar sustancias citotóxicas, toxinas o enzimas que provoquen la lisis de las células, con un fin terapéutico. A los anticuerpos monoclonales también se les puede atribuir una finalidad más asequible, que es la producción de vacunas de anticuerpos antiidiotipo y, en particular, vacunas de anticuerpos antiparatope (C. Bona, comunicación personal). El paratope es el sitio de fijación dentro del intersti-

19 695 cio del fragmento F a b del anticuerpo, y es el complemento molecular del epítope específico del antígeno estimulador. Siendo extranjeros al organismo animal, los paratopes suscitan anticuerpos que tienen sitios imitando los epítopes del antígeno original. Por consiguiente, los anticuerpos antiparatopes tienen actividad vacunante, particularmente después de multiplicación dentro de hibridomas o clonaje y expresión dentro de organismos unicelulares, o dentro de un ADN complementario con doble cadena elaborado a partir del ARN mensajero del anticuerpo antiparatope. Los anticuerpos monoclonales también permiten esperar buenos resultados sustituyéndose a los sueros antivenenosos elaborados sobre el conejo o el caballo. Se preparan actualmente antivenenos monoclonales dirigidos específicamente contra el elemento enzimático de tipo lipasa del veneno de araña «viuda negra» que es más peligroso que el veneno de la serpiente de cascabel (79). Existen indicaciones de la superioridad del antiveneno monoclonal en relación con el antiveneno natural producido sobre el conejo. INTERFERONES PARA ANIMALES Los interferones descritos en 1957 (80) y ampliamente estudiados desde aquella época comprenden un grupo algo heterogéneo de proteínas divididas en clases llamadas a, B y y. Los interferones modulan una cierta cantidad de actividades inmunológicas importantes, particularmente la producción de anticuerpos, la hipersensibilidad inmediata y retrasada, las actividades citotóxicas y las funciones de los macrofagos (81). Las clases a, B y y de interferones son producidas respectivamente dentro de los leucocitos, los fibroblastos y las células epiteliales, y los linfocitos como reacción contra una variedad de inductores tales como : virus, polinucleótidos y productos bacterianos para los interferones a y B, y los antígenos, los complejos antígeno-anticuerpo, el suero antilinfocitario y mitógenos para los interferones y. Las interpretaciones referentes a la inducción y a las funciones de los interferones a menudo han sido poco concluyentes por ser muchos los parámetros que intervienen, y bajas las cantidades y calidades de los interferones estudiados. Estos tres últimos años, se lograron elaborar mejores producciones de interferones en escala industrial, sobre cultivos celulares. Hace muy poco, un interferón de recombinación prácticamente puro se ha elaborado a base de E. coli, en cantidad suficiente para realizar pruebas clínicas en los trastornos inmunológicos, enfermedades infecciosas y tumores. Los interferones parecían inicialmente poseer una especificidad ligada a la especie animal, es decir que el interferón producido por células de ternero protegía a las células de ternero y no a las de pollo, contra la infección por un virus, y viceversa (82). Se sabe hoy que este carácter es variable y depende en parte de la clase del interferón; así pues ciertos interferones a humanos protegen a las células de

20 696 otras especies y en cambio, los interferones B humanos no lo hacen. Por ejemplo, los interferones a humanos de recombinación protegen a los ratones contra dosis mortales del virus de la encefalomiocarditis (83). Además, las técnicas de recombinación del ADN han producido interferones híbridos cuya actividad es bastante elevada frente a las cepas celulares humanas, bovinas y murinas. Si observamos varias enfermedades auto-inmunes, la frecuencia y la concentración de interferones parecen ser generalmente más elevadas en la persona enferma que en los individuos sanos. El papel exacto representado por el interferón en estas enfermedades no queda claro, pero la administración de interferón a los ratones negros de Nueva Zelanda acelera el lupus eritematoso frecuente en estos animales (84). Se comprueba lo mismo con las infecciones herpéticas de tipo zona, que parecen ser menos frecuentes en los individuos atacados por un lupus eritematoso evolutivo que en los que sufren una afección latente, lo que al parecer se debe a las dosis más elevadas de interferón en el primer grupo. Al contrario, ciertas enfermedades como los tumores linfoides, ciertas afecciones auto-inmunes o virales y ciertas inmunodeficiencias van unidas a una disminución de la producción del interferón y (81). Muchos puntos necesitan ser aclarados referentes al modo de actuación específica y a la eficacia terapéutica de los interferones, pero la actual disponibilidad de interferones de recombinación ofrece el material necesario para pruebas clínicas en las afecciones virales y tumorales del hombre. De los resultados de estos trabajos, se sacarán eventuales beneficios para la medicina veterinaria, por ejemplo para el tratamiento de reproductores valiosos, caballos de carreras, animales de exposición o de compañía. Como el interferón debe, generalmente, ser inyectado por lo menos una vez por día durante varios días, los métodos de inyección programada serían de gran interés. * Anexo 51 SESIÓN GENERAL DE LA O.I.E. RESOLUCIÓN II APLICACIONES DE LOS PROGRESOS DE INGENIERÍA GENÉTICA EN LA LUCHA CONTRA LAS ENFERMEDADES ANIMALES CONSIDERANDO que la ingeniería genética constituye una de nuestras más recientes adquisiciones tecnológicas y que muchos laboratorios están trabajando actualmente con objeto de aplicar esta tecnología para mejorar la calidad, cantidad, inocuidad y costo de las vacunas destinadas para los animales,

II. MECANISMOS INMUNOLÓGICOS. Enzimas y otras proteínas de acción local. Anticuerpos. Respuesta humoral. Complemento. Interferones (α,β,γ)

II. MECANISMOS INMUNOLÓGICOS. Enzimas y otras proteínas de acción local. Anticuerpos. Respuesta humoral. Complemento. Interferones (α,β,γ) TEMA 24.- Inmunidad frente a virus. Mecanismos inmunitarios innatos y adquiridos. Estrategias de los virus para eludir la Respuesta Inmune. Consecuencias perjudiciales de la R.I. frente a virus. OBJETIVOS

Más detalles


GENES Y MANIPULACIÓN GENÉTICA GENES Y MANIPULACIÓN GENÉTICA El ADN, material de los genes La información que controla la aparición de los caracteres hereditarios se localiza en el interior del núcleo celular y se transmite de célula

Más detalles

Vacunas: protegen al establecer una resistencia inmunológica a patógenos

Vacunas: protegen al establecer una resistencia inmunológica a patógenos Vacunas Vacunas: protegen al establecer una resistencia inmunológica a patógenos Hospedero produce anticuerpos Dr. Edward Jenner en 1796 infecto a un niño con cowpox Protegido contra smallpox 2 millones

Más detalles

DNA RECONBINANTE Depende de enzimas capaces de: Cortar Unir Replicar Transcribir inversamente el RNA Otra herramienta es el uso de Sondas específicas

DNA RECONBINANTE Depende de enzimas capaces de: Cortar Unir Replicar Transcribir inversamente el RNA Otra herramienta es el uso de Sondas específicas DNA RECONBINANTE Depende de enzimas capaces de: Cortar Unir Replicar Transcribir inversamente el RNA Otra herramienta es el uso de Sondas específicas ELEMENTOS BÁSICOS DE LA INVESTIGACIÓN EN GENES Análisis

Más detalles


1. PRINCIPALES VIRUS TRANSMITIDOS POR EL AGUA. Son organismos que pueden causar infecciones y que solo se reproducen en células huésped. Los virus fuera de células huésped están en forma inactiva. Se caracterizan por presentar una capa protectora.

Más detalles


VIROLOGÍA. Dra. FLOR TERESA GARCÍA HUAMÁN 2 VIROLOGÍA Virología es el estudio de los virus, su clasificación y evolución, su estructura, sus formas, replicación, enfermedades que causan, las técnicas para aislar y su uso en la investigación y terapia.

Más detalles


QUÉ ES BIOLOGÍA MOLECULAR Y BIOTECNOLOGÍA. Julio A. Carrasco Vallejo Julio 2014 QUÉ ES BIOLOGÍA MOLECULAR Y BIOTECNOLOGÍA Julio A. Carrasco Vallejo Julio 2014 Definiciones Biología Molecular: Estudio de los flujos de información genética en una célula Biotecnología: Uso de sistemas

Más detalles

b) Qué relación tienen los conceptos anteriores con las vacunas y los sueros?

b) Qué relación tienen los conceptos anteriores con las vacunas y los sueros? PREGUNTAS Y RESPUESTAS DE INMUNOLOGÍA 1. a) Define antígeno y anticuerpo. b) Qué relación tienen los conceptos anteriores con las vacunas y los sueros? 1. a) Los antígenos forman un conjunto de moléculas

Más detalles


INTRODUCCION A LA VIROLOGIA INTRODUCCION A LA VIROLOGIA Dra.Dora Ruchansky Prof. adjunta del Dpto.Bacteriología y Virología. Facultad de Medicina - U.D.E.L.A.R Indicios de Enfermedades Virales en la Antigüedad Piedra tallada en una

Más detalles

Presentación didáctica montada por Jose Antonio Pascual Trillo

Presentación didáctica montada por Jose Antonio Pascual Trillo Virus envuelto Cápsida (capsómeros) Ácido nucleico Envoltura membranosa (solo algunos) Brotación de un virus con envoltura FORMAS DE LOS VIRUS Poligonal/icosaédrico Helicoidal Poligonal con envoltura Complejo

Más detalles

ESPECIE CROMOSOMA DENOMINACIÓN (complejo o región) Humano 6 HLA Ratón 17 H-2 Porcino 7 SLA Bovino 23 BoLA Équidos 20 ELA Pollo 16 B

ESPECIE CROMOSOMA DENOMINACIÓN (complejo o región) Humano 6 HLA Ratón 17 H-2 Porcino 7 SLA Bovino 23 BoLA Équidos 20 ELA Pollo 16 B TEMA 6. COMPLEJO MAYOR DE HISTOCOMPATIBILIDAD. Concepto y clases. Funciones y características. Moléculas de Clase I. Moléculas de Clase II. Presentación de antígeno. Relación entre el CMH y la enfermedad

Más detalles

OBJETIVO: Los estudiantes podrán: Pg. 1

OBJETIVO: Los estudiantes podrán: Pg. 1 DURACIÓN: 60 Minutos GRADO: 3-5, 6-8, 9-12 MATERIAS: TODO SOBRE LOS VIRUS DESCRIPCIÓN: Incluso a medida que usted lee estas líneas, su cuerpo está siendo atacado. Su enemigo es paciente, adaptable, potencialmente

Más detalles

PRUEBA ACCESO A CICLOS FORMATIVOS DE GRADO SUPERIOR OPCIÓN C BIOLOGÍA. Lee atentamente el texto y las preguntas antes de contestar.

PRUEBA ACCESO A CICLOS FORMATIVOS DE GRADO SUPERIOR OPCIÓN C BIOLOGÍA. Lee atentamente el texto y las preguntas antes de contestar. PRUEBA ACCESO A CICLOS FORMATIVOS DE GRADO SUPERIOR OPCIÓN C BIOLOGÍA DATOS DEL ASPIRANTE Apellidos: CALIFICACIÓN PRUEBA Nombre: D.N.I. o Pasaporte: Fecha de nacimiento: / / Instrucciones: Lee atentamente

Más detalles

Fabricación de Terapias Genéticas: Cómo Asegurar la Seguridad y Calidad de los Productos

Fabricación de Terapias Genéticas: Cómo Asegurar la Seguridad y Calidad de los Productos Fabricación de Terapias Genéticas: Cómo Asegurar la Seguridad y Calidad de los Productos DIAPOSITIVA 1 Esta presentación discutirá la fabricación de productos de terapias genéticas para asegurar la seguridad

Más detalles

Cultura Cientí fica 1 Bachillerato

Cultura Cientí fica 1 Bachillerato Cultura Cientí fica 1 Bachillerato 3. La revolución genética: biotecnología Actividades de consolidación 1. Cualquier molécula de ADN formada por la unión de segmentos de ADN de origen diferente es: a)

Más detalles


CAPITULO 1 ESTRUCTURA Y CLASIFICACIÓN DE VIRUS CAPITULO 1 Virología Médica 3 ESTRUCTURA Y CLASIFICACIÓN DE VIRUS La palabra virus significa veneno y corresponde a la denominación que se le dio originalmente a fines del siglo XVIII a ciertas sustancias

Más detalles


1.INMUNIZACIÓN ACTIVA Y PASIVA INMUNOLOGÍA(II) 1.INMUNIZACIÓN ACTIVA Y PASIVA La inmunización es un procedimiento que tiene como finalidad aumentar la eficacia de la respuesta inmunitaria del organismo frente a las enfermedades infecciosas

Más detalles

7.012 Serie de ejercicios 5

7.012 Serie de ejercicios 5 Nombre Grupo 7.012 Serie de ejercicios 5 Pregunta 1 Al estudiar los problemas de esterilidad, usted intenta aislar un hipotético gen de conejo que explique la prolífica reproducción de estos animales.

Más detalles

Qué es un gen? EXPRESION GÉNICA 01/05/2013

Qué es un gen? EXPRESION GÉNICA 01/05/2013 Qué es un gen? Es una secuencia de nucleótidos en la molécula de ADN, equivalente a una unidad de transcripción. Contiene la información, a partir de la cual se sintetiza un polipéptido, una enzima, un

Más detalles


LA BIOTECNOLOGÍA HACE TU VIDA MEJOR Y MÁS FÁCIL LA BIOTECNOLOGÍA HACE TU VIDA MEJOR Y MÁS FÁCIL BIOTECNOLOGÍA APLICADA A LA SALUD La Biotecnología está presente en la Medicina y en la Salud animal, ya que participa en el diagnóstico y en el tratamiento

Más detalles


FARMACOPEA MERCOSUR: VACUNAS PARA USO HUMANO MERCOSUR/XLII SGT Nº 11/P.RES. Nº 09/14 FARMACOPEA MERCOSUR: VACUNAS PARA USO HUMANO VISTO: El Tratado de Asunción, el Protocolo de Ouro Preto y las Resoluciones N 31/11 y 22/14 del Grupo Mercado Común.

Más detalles

GENÉTICA BACTERIANA. Elementos genéticos. GENOMA BACTERIANO es el conjunto de elementos genéticos autorreplicativos que tiene una bacteria

GENÉTICA BACTERIANA. Elementos genéticos. GENOMA BACTERIANO es el conjunto de elementos genéticos autorreplicativos que tiene una bacteria GENÉTICA BACTERIANA I. Elementos genéticos I. Elementos genéticos II. Variabilidad genética III. Genómica y concepto de especie GENOMA BACTERIANO es el conjunto de elementos genéticos autorreplicativos

Más detalles


TEMA 4 CMC BIOTECNOLOGÍA Conceptos Tema 4 TEMA 4 CMC BIOTECNOLOGÍA Células eucariotas: Células con núcleo. Núcleo: Un compartimento en el interior de la célula que alberga el material genético. Citoplasma: En una célula eucariota,

Más detalles

Los polímeros naturales están presentes en sustancias como la celulosa, el caucho natural y la seda, pero su mayor relevancia está al interior de

Los polímeros naturales están presentes en sustancias como la celulosa, el caucho natural y la seda, pero su mayor relevancia está al interior de Polímeros Naturales Los polímeros naturales están presentes en sustancias como la celulosa, el caucho natural y la seda, pero su mayor relevancia está al interior de nuestro propio cuerpo y se denomina

Más detalles

El desarrollo de la Virología

El desarrollo de la Virología LOS VIRUS El desarrollo de la Virología Literatura china del siglo X a.j.c.: Se describe una enfermedad similar a la viruela. Desde el siglo XVIII se vacuna contra la viruela vacuna (Jenner). En 1884 Pasteur

Más detalles

A principios de los años ochentas el desarrollo de nuevas tecnologías para la

A principios de los años ochentas el desarrollo de nuevas tecnologías para la Nuevos marcadores para la detección temprana y predicción de sobrevida en blancos terapéuticos. A principios de los años ochentas el desarrollo de nuevas tecnologías para la identificación del ADN del

Más detalles

1. Cuáles son las diferencias en los componentes químicos del ADN y ARN?

1. Cuáles son las diferencias en los componentes químicos del ADN y ARN? ACTIVIDADES TEMA 4 - BIOTECNOLOGÍA 1. Cuáles son las diferencias en los componentes químicos del ADN y ARN? Las cadenas de ADN están formadas por fosfato y desoxirribosa y la del ARN por fosfato y ribosa.

Más detalles



Más detalles

5. BIOLOGÍA. BACHILLERATO (LOGSE) Prueba de acceso a la Universidad. Ejercicio de BIOLOGIA. Segunda parte de la prueba

5. BIOLOGÍA. BACHILLERATO (LOGSE) Prueba de acceso a la Universidad. Ejercicio de BIOLOGIA. Segunda parte de la prueba 84 5. BIOLOGÍA BACHILLERATO (LOGSE) Prueba de acceso a la Universidad Ejercicio de BIOLOGIA Segunda parte de la prueba Modalidad de Ciencias de la Naturaleza y de la Salud Materia obligatoria en la via

Más detalles

Proteínas. Tabla 1: Funciones de las proteínas

Proteínas. Tabla 1: Funciones de las proteínas Colegio Lectura Hispano Complementaria Americano Depto. de Ciencias - Biología Nivel: 4to medio Unidad I Proteínas 1 En las células, son las proteínas las macromoléculas más abundantes y las que constituyen

Más detalles



Más detalles

económicos. Fáciles de usar y de interpretar. Máximo rigor diagnóstico al alcance del veterinario clínico.

económicos. Fáciles de usar y de interpretar. Máximo rigor diagnóstico al alcance del veterinario clínico. Rápidos, fiables, económicos. Fáciles de usar y de interpretar. Máximo rigor diagnóstico al alcance del veterinario clínico. Las inmunocromatografías Las técnicas inmunocromatográficas han sido una importante

Más detalles


AMINOÁCIDOS SE PUEDEN UNIR POR ENLACES PEPTÍDICOS Tema 4. Proteínas: funciones biológicas y estructura primaria. Enlace peptídico. Péptidos y proteínas. Diversidad de funciones biológicas. Niveles de organización estructural de las proteínas. Separación

Más detalles


TP 4. ENFERMEDADES EXOTICAS DE LOS SUIDOS. TP 4. ENFERMEDADES EXOTICAS DE LOS SUIDOS. 1.- ENCEFALOMIELITIS ENTEROVIRICA PORCINA 1) El agente causal de la EEP: a. Es relativamente poco infeccioso. b. Es un virus ARN monocatenario con envuelta, de

Más detalles

Análisis de la Respuesta Inmunitaria a las vacunas

Análisis de la Respuesta Inmunitaria a las vacunas Análisis de la Respuesta Inmunitaria a las vacunas José Ignacio Santos Profesor de Medicina Experimental Jefe de la Subdivisión de Investigación Clínica Facultad de Medicina Universidad Nacional Autónoma

Más detalles

R3AIC Dra. Patricia María O Farrill Romanillos

R3AIC Dra. Patricia María O Farrill Romanillos R3AIC Dra. Patricia María O Farrill Romanillos Características generales de las respuestas inmunitarias frente a microrganismos Aunque las respuestas defensivas antimicrobianas del huésped son numerosas

Más detalles

Diagnóstico microbiológico de la infección por HIV

Diagnóstico microbiológico de la infección por HIV Diagnóstico microbiológico de la infección por HIV Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Alicante E-mail: rodriguez_juadia@gva.es http://microbiología-alicante.umh.es

Más detalles

Introducción al Inmunodiagnóstico.

Introducción al Inmunodiagnóstico. UNIVRSIDAD D LOS ANDS FACULTAD D FARMACIA Y BIOANÁLISIS CATDRA D INMUNOLOGÍA Introducción al Inmunodiagnóstico. César Pérez-Maldonado,PhD. 2009. INMUNIDAD Mecanismos de Defensa (specíficos / Inespecíficos)

Más detalles

Capítulo 7.3. Resumen para no expertos

Capítulo 7.3. Resumen para no expertos Resumen para no expertos Comunicación bacteriana y síntesis de antibióticos La comunicación es un factor esencial para todos los seres vivos. Las bacterias, en concreto, se comunican utilizando pequeños

Más detalles


PRUEBAS DE ACCESO A CICLOS FORMATIVOS DE GRADO SUPERIOR Convocatoria mayo de 2005 BIOLOGIA Convocatoria mayo de 2005 BIOLOGIA a) El ADN es la molécula portadora del mensaje genético: define cómo está compuesto el ADN y qué diferencias existen entre el ADN y el ARN b) Explica qué es un gen y

Más detalles

Enzimas de restricción

Enzimas de restricción BIOTECNOLOGIA Enzimas de restricción Endonucleasas que reconocen dianas específicas en el ADN Protegen a cada cepa de bacterias de otro ADN que no pertenece al sistema El ADN propio está protegido porque

Más detalles

Patogenia, latencia y reactivación de las infecciones provocadas por herpesvirus

Patogenia, latencia y reactivación de las infecciones provocadas por herpesvirus Rev. sec. tech. Off. int. Epiz., 1986, 5 (4), 829-836. Patogenia, latencia y reactivación de las infecciones provocadas por herpesvirus E. THIRY, J. DUBUISSON y P.-P. PASTORET* Resumen : Después de un

Más detalles

Oferta tecnológica: Método para detectar inserciones de espaciadores en estructuras CRISPR

Oferta tecnológica: Método para detectar inserciones de espaciadores en estructuras CRISPR Oferta tecnológica: Método para detectar inserciones de espaciadores en estructuras CRISPR Oferta tecnológica: Método para detectar inserciones de espaciadores en estructuras CRISPR. RESUMEN Las repeticiones

Más detalles

Clonación molecular. Clonar significa hacer copias idénticas

Clonación molecular. Clonar significa hacer copias idénticas INGENIERÍA GENÉTICA Clonación molecular Clonar significa hacer copias idénticas Este término originalmente fue aplicado al procedimiento de aislar una célula y permitirle reproducirse creando una población

Más detalles



Más detalles

1) a) En la figura señale, englobando con un trazo continuo, lo siguiente:

1) a) En la figura señale, englobando con un trazo continuo, lo siguiente: CÁTEDRA: BIOQUÍMICA Carreras: Farmacia Profesorado en Química Licenciatura en Química Licenciatura en Alimentos ÁCIDOS NUCLEICOS 1) a) En la figura señale, englobando con un trazo continuo, lo siguiente:

Más detalles

TEMA 5 TEMA 6. 7. La célula tiene que saber la ruta a emplear en cada momento, cómo regula estos procesos de manera primaria?.

TEMA 5 TEMA 6. 7. La célula tiene que saber la ruta a emplear en cada momento, cómo regula estos procesos de manera primaria?. TEMA 1 1. El agua es uno de los principales elementos de los seres vivos, por qué es tan importante?. 2. Las proteínas son polímeros de aminoácidos, cuáles son las características básicas de los aminoácidos

Más detalles

Ingeniería Genética II

Ingeniería Genética II Ingeniería Genética II Expresión de proteínas recombinantes Vectores de expresión Características adicionales: - Promotor regulable - Terminador de la transcripción - Sitio de reconocimiento por el ribosoma

Más detalles

Vacunas contra la hepatitis A. Documento de posición de la OMS

Vacunas contra la hepatitis A. Documento de posición de la OMS Vacunas contra la hepatitis A Documento de posición de la OMS La Organización Mundial de la Salud (OMS), por medio de su Departamento de Vacunas y Productos Biológicos 1, ya ofrece información y recomendaciones

Más detalles

Biología I. Biología I. Tema 10. El mundo de los virus

Biología I. Biología I. Tema 10. El mundo de los virus Biología I Tema 10. El mundo de los virus 1 Objetivo de aprendizaje del tema Al finalizar el tema serás capaz de: Definir qué es un virus y mencionar sus antecedentes. Enunciar las características más

Más detalles

Julio M. Delgado Biotechnova S.A.S direccioncientifica@biotechnova.com

Julio M. Delgado Biotechnova S.A.S direccioncientifica@biotechnova.com MEDICAMENTOS BIOTECNOLOGICOS INTERFERON Y OTROS Julio M. Delgado Biotechnova S.A.S direccioncientifica@biotechnova.com Que se Consideran Fármacos Biotecnológicos? Que es un Biofármaco? Biológicos: Producto

Más detalles



Más detalles


P.L.JOSEPH, D.A. ESPESETH, G.P. SHIBLEY y C.G. GAY ** Rev. sci. tech. Off. int. Epiz., 1988, 7 (2), 293-300. Consideraciones referentes al medio ambiente para pruebas a campo y licensamiento de productos biológicos vivos de uso veterinario fabricados por

Más detalles

FeLV Ag / FIV Ab Test Kit

FeLV Ag / FIV Ab Test Kit SensPERT FeLV Ag / FIV Ab Test Kit CONCEPTO SENSPERT La línea de diagnóstico SensPERT de Rapid Test proporciona una solución rápida, específica y fiable para los médicos veterinarios en su práctica clínica

Más detalles


INGENIERÍA GENÉTICA 5 GAATTC 3 3 CTTAAG 5 INGENIERÍA GENÉTICA 1. Fundamentos básicos de la ingeniería genética 2. Desnaturalización e hibridación del ADN 3. Reacción en cadena de la polimerasa (PCR) 4. Nuevas disciplinas surgidas de la ingeniería

Más detalles

Alteraciones del sistema inmune. Unidad 4 / Inmunología una Mirada Preventiva

Alteraciones del sistema inmune. Unidad 4 / Inmunología una Mirada Preventiva Alteraciones del sistema inmune Unidad 4 / Inmunología una Mirada Preventiva Índice Introducción Lección 1. Alergias y Síndrome de Inmunodeficiencia adquirida a) Alergias. Qué es la alergia? Síntomas de

Más detalles

Microbiología General 2006-2007. Tema 5: Transmisión de la información genética

Microbiología General 2006-2007. Tema 5: Transmisión de la información genética Microbiología General 2006-2007 Tema 5: Transmisión de la información genética Transmisión de la información genética Reparto del material genético en procariontes y eucariontes. Transferencia horizontal

Más detalles


5-MARCO DE REFERENCIA 5-MARCO DE REFERENCIA Para hablar de pruebas diagnosticas es necesario el conocimiento de ciertos términos que a continuación se describen. Sensibilidad: Es la probabilidad de obtener una prueba positiva

Más detalles

TEST DE NIVEL BASICO. 1. Únicamente las bacterias Gram negativas tienen: a) Exotoxinas b) Peptidoglicano c) Lipopolisacárido d) Plásmidos

TEST DE NIVEL BASICO. 1. Únicamente las bacterias Gram negativas tienen: a) Exotoxinas b) Peptidoglicano c) Lipopolisacárido d) Plásmidos TEST DE NIVEL BASICO 1. Únicamente las bacterias Gram negativas tienen: a) Exotoxinas b) Peptidoglicano c) Lipopolisacárido d) Plásmidos 2. Los genes de virulencia de una especie bacteriana patógena: a)

Más detalles

Virus Son o no son organismos vivos?

Virus Son o no son organismos vivos? Virus Son o no son organismos vivos? Contienen un solo tipo de ácido nucleico, ADN o ARN. Se multiplican dentro de células vivas, utilizando la maquinaria de síntesis de la célula. Provocan la síntesis

Más detalles

Inmunidad Antitumoral

Inmunidad Antitumoral Inmunidad Antitumoral Conceptos a desarrollar 1- Transformación celular y cáncer 2- Mecanismos celulares de supresión tumoral 3- Antígenos tumorales 4- El Sistema inmune ante el desarrollo tumoral 5- Mecanismos

Más detalles


EL ADN y la INGENIERÍA GENÉTICA IES LAS VIÑAS MANILVA. MÁLAGA. CMC. Susana Serradilla EL ADN y la INGENIERÍA GENÉTICA EL GENOMA HUMANO GENOMA: Conjunto de genes de un ser vivo. GENOMA HUMANO: Conjunto de genes de la especie humana PROYECTO

Más detalles


REPASANDO CONCEPTOS : LAS PROTEÍNAS REPASANDO CONCEPTOS : LAS PROTEÍNAS Drqf. Manuel Fontboté A. Consultor en Ciencias Cosméticas CHILE El uso de materias activas de naturaleza proteica en los cosméticos no es un hecho reciente, antes bien,

Más detalles

III. Material genético. b. Composición y estructura del RNA.

III. Material genético. b. Composición y estructura del RNA. III. Material genético b. Composición y estructura del RNA. RNA (ácido ribonucléico) Polímero de nucleótidos La pentosa de los nucleótidos es la Ribosa: en la posición 2' del anillo del azúcar hay un grupo

Más detalles

La Seguridad Viral de los Productos Derivados del Plasma

La Seguridad Viral de los Productos Derivados del Plasma La Seguridad Viral de los Productos Derivados del Plasma DIAPOSITIVA 1 Esta presentación abarcará los estudios de validación viral para los productos derivados del plasma. La FDA exige que el proceso manufacturero

Más detalles

Técnicas de Biología Molecular

Técnicas de Biología Molecular Técnicas de Biología Molecular DNA I. Enzimas de restricción Análisis Las enzimas de restricción fueron aisladas de bacterias; su función natural es proteger contra DNA extraño II. Separación electroforética

Más detalles

Práctico: Genética bacteriana 2007.

Práctico: Genética bacteriana 2007. Práctico: Genética bacteriana 2007. Actividad integrada Departamento de Genética Departamento de Bacteriología y Virología. OBJETIVOS Objetivos generales El estudiante al terminar la actividad práctica

Más detalles


VACUNACIONES MV. LISSIE PALACIOS HURTADO VACUNACIONES MV. LISSIE PALACIOS HURTADO Objetivo de la vacunación: Es tarea primordial del médico veterinario trabajar en la erradicación de las diferentes enfermedades que aquejan a los animales y pueden

Más detalles

Name Date Class. [Comienzo de Sección 11-1] Por favor pasa a la página 226 para empezar la Sección 11-1, La Ingeniería Genética.

Name Date Class. [Comienzo de Sección 11-1] Por favor pasa a la página 226 para empezar la Sección 11-1, La Ingeniería Genética. [Introducción] Por favor abre tu libro en la página 225. Capítulo 11: La Tecnología de Genes Los científicos trabajan día a día en búsqueda de nuevas formas para el uso de la tecnología genética en beneficio

Más detalles

Terapia Génica. Dra. Lizbeth Salazar-Sànchez Escuela de Medicina Universidad de Costa Rica

Terapia Génica. Dra. Lizbeth Salazar-Sànchez Escuela de Medicina Universidad de Costa Rica Terapia Génica Dra. Lizbeth Salazar-Sànchez Escuela de Medicina Universidad de Costa Rica 5/8/2015 Gen Esta en un cromosoma Es la unidad base de la Herencia Codificación, proteína DNA RNA proteins Proteínas,

Más detalles


ADN, ARN E INFORMACIÓN ADN, ARN E INFORMACIÓN LOS ÁCIDOS NUCLEICOS Los ácidos nucleicos fueron descubiertos en 1869 por Miescher, en el pus de los vendajes de heridas, pero su papel en la herencia y control de la actividad celular

Más detalles

Incidencia de Hepatitis por cuerpos de inclusión y Planes de Control

Incidencia de Hepatitis por cuerpos de inclusión y Planes de Control Introducción Incidencia de Hepatitis por cuerpos de inclusión y Planes de Control Pedro Villegas-Narváez Universidad de Georgia Centro de Diagnóstico e Investigación Aviar Facultad de Medicina Veterinaria

Más detalles

Principios de Vacunología

Principios de Vacunología Principios de Vacunología José Ignacio Santos Profesor de Medicina Experimental Jefe de la Subdivisión de Investigación Clínica Facultad de Medicina Universidad Nacional Autónoma de México Lunes 26 de

Más detalles


RIESGOS BIOLÓGICOS GENERALIDADES GENERALIDADES Definición Algunas de las tareas que desempeñan ciertos colectivos de trabajadores, conllevan riesgos vinculados a la exposición a agentes biológicos como: Virus, bacterias y parásitos, susceptibles

Más detalles

AQUAGESTION. ISAv: Un acercamiento actualizado en la detección de sus variantes en la región. Departamento de Desarrollo y Laboratorio Diagnóstico.

AQUAGESTION. ISAv: Un acercamiento actualizado en la detección de sus variantes en la región. Departamento de Desarrollo y Laboratorio Diagnóstico. AQUAGESTION ISAv: Un acercamiento actualizado en la detección de sus variantes en la región. Departamento de Desarrollo y Laboratorio Diagnóstico. Noviembre 2011 ACTUALIDAD Este año Sernapesca confirma

Más detalles



Más detalles

Guiones de Clase Inmunología 2011-2012 Prof. JM Sánchez-Vizcaíno 1

Guiones de Clase Inmunología 2011-2012 Prof. JM Sánchez-Vizcaíno 1 1 Resp. 3 Votos 4 5 6 % 7 8 9 10 1 2 3 4 15256 7 8 9 20 1 2 3 504 25 6 7 8 9 30 1 75 2 3 4 35 6 7 8 9 100 40 1 2 V.1.3.1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Participantes

Más detalles



Más detalles

Algunos aspectos a tener en cuenta en la salud de las mascotas

Algunos aspectos a tener en cuenta en la salud de las mascotas Algunos aspectos a tener en cuenta en la salud de las mascotas Dr. Rodrigo Puentes Área de Inmunología Dpto. Ciencias Microbiológicas Facultad de Veterinaria UdelaR rpuentes@adinet.com.uy Montevideo Uruguay

Más detalles

5. La infección hospitalaria: herramientas para su control

5. La infección hospitalaria: herramientas para su control 5. La infección hospitalaria: herramientas para su control Por definición se considera infección nosocomial o de adquisición hospitalaria a la que no está presente ni se está incubando en el momento del

Más detalles

Tecnología de DNA recombinante I

Tecnología de DNA recombinante I Tecnología de DNA recombinante I Base: capacidad de manipular moléculas de DNA en un tubo de ensayo Enzimas: Purificadas, con actividades conocidas y controladas DNA polimerasas Síntesis de DNA Nucleasas

Más detalles

Caso. Paciente de 1 año sexo masculino. Consulta por fiebre y deshidratación. Presenta fiebre, diarrea, emesis y oliguria de dos dias de evolución.

Caso. Paciente de 1 año sexo masculino. Consulta por fiebre y deshidratación. Presenta fiebre, diarrea, emesis y oliguria de dos dias de evolución. DIARREAS VIRALES Caso Paciente de 1 año sexo masculino. Consulta por fiebre y deshidratación. Presenta fiebre, diarrea, emesis y oliguria de dos dias de evolución. 39.5 ºC, taquicardia ligera. Presenta

Más detalles

Virus RNA. Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Alicante

Virus RNA. Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Alicante Virus RNA Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Alicante Ciclo biológico de los virus RNA Fase de infección Fijación de la partícula vírica a la célula Entrada del

Más detalles

Pandemia de Gripe A H1N1. Características del Agente Infeccioso. Aspectos a Considerar en los Planes de Actuación Clínica y de Salud Pública

Pandemia de Gripe A H1N1. Características del Agente Infeccioso. Aspectos a Considerar en los Planes de Actuación Clínica y de Salud Pública Pandemia de Gripe A H1N1. Características del Agente Infeccioso. Aspectos a Considerar en los Planes de Actuación Clínica y de Salud Pública Dr. Jose Luis del Pozo Área de Enfermedades Infecciosas Servicio

Más detalles


2do. CURSO DE FORMACION DE VACUNADORES 2do. CURSO DE FORMACION DE VACUNADORES Comisión Honoraria para la Lucha Antituberculosa y Enfermedades Prevalentes Departamento de Inmunizaciones Dr. Fernando Arrieta VACUNAS GENERALIDADES VACUNA: DEFINICIÓN

Más detalles

Hepatitis virales. Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Elche

Hepatitis virales. Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Elche Hepatitis virales Juan Carlos Rodríguez Díaz S. Microbiología Hospital General Universitario de Elche Hepatitis Características generales Es un proceso asociado a muchas causas, tanto infecciosas como

Más detalles

Metodologías básicas del procesamiento de Proteinas

Metodologías básicas del procesamiento de Proteinas Metodologías básicas del procesamiento de Proteinas Alejandra Kun Departamento de Proteínas y Ácidos Nucleicos-IIBCE Unidad Asociada Sección Bioquímica Facultad de Ciencias 13 de octubre 2014 Curso Introducción

Más detalles

2. Las inmunoglobulinas. Estructura, propiedades y funciones biológicas.

2. Las inmunoglobulinas. Estructura, propiedades y funciones biológicas. Bioquímica inmunológica 2. Las inmunoglobulinas. Estructura, propiedades y funciones biológicas. - + Proteína (Densitometría) Proteínas IgG IgA IgM IgD Albúmina Movilidad electroforética Las inmunoglobulinas

Más detalles

Retrovirus del gato. Agenda. Familia Retroviridae. Familia Retroviridae (i) Enfermedades Infecciosas de los Felinos

Retrovirus del gato. Agenda. Familia Retroviridae. Familia Retroviridae (i) Enfermedades Infecciosas de los Felinos Enfermedades Infecciosas de los Felinos Agenda 2 Parte 04-OCT-2010 Complejo inmunosupresor felino Vet. Fabián Grimoldi Facultad de Ciencias Veterinarias Universidad de Buenos Aires Familia Retroviridae

Más detalles

Los resultados serológicos. Limitaciones y aplicaciones prácticas para la enfermedad de Gumboro

Los resultados serológicos. Limitaciones y aplicaciones prácticas para la enfermedad de Gumboro PATOLOGÍA LOS RESULTADOS SEROLÓGICOS. LIMITACIONES Y APLICACIONES PRÁCTICAS PARA LA ENFERMEDAD DE GUMBORO Los resultados serológicos. Limitaciones y aplicaciones prácticas para la enfermedad de Gumboro

Más detalles

Enfermedades reemergentes en la producción del broiler. Qué nos espera en los próximos años?

Enfermedades reemergentes en la producción del broiler. Qué nos espera en los próximos años? Enfermedades reemergentes en la producción del broiler. Qué nos espera en los próximos años? Sumario En la actualidad están apareciendo muchas enfermedades bacterianas que se consideran reemergentes dado

Más detalles

Soluciones de la serie de ejercicios 4 (Curso 7.012)

Soluciones de la serie de ejercicios 4 (Curso 7.012) Pregunta 1 Soluciones de la serie de ejercicios 4 (Curso 7.012) Usted está estudiando la síntesis del aminoácido triptófano en las bacterias. Las enzimas TrpA, TrpB, TrpC, TrpD, TrpE and AroH son necesarias

Más detalles

PCR gen 18S ARNr humano

PCR gen 18S ARNr humano PCR gen 18S ARNr humano Ref.PCR18S 1.OBJETIVO DEL EXPERIMENTO El objetivo de este experimento es introducir a los estudiantes en los principios y práctica de la Reacción en Cadena de la Polimerasa (PCR)

Más detalles

Paloma Rodríguez Rodríguez

Paloma Rodríguez Rodríguez Paloma Rodríguez Rodríguez AVANCES TECNOLÓGICOS M. Electrónica + Secuenciación y comparación genómica / aminoacídica Diversidad y Abundancia Cadenas tróficas microbianas Redes tróficas globales Presentes

Más detalles


CICLO DE REPLICACIÓN VIRAL. ETAPAS CICLO DE REPLICACIÓN VIRAL. ETAPAS Adsorción del virus al receptor celular Penetración del virus a la célula Decapsidación ó desnudamiento Replicación del genoma viral Síntesis de proteínas virales Ensamblaje

Más detalles

Sistema inmunitario. respuesta inmune elementos extraños (antígenos) respuesta celular: respuesta humoral: inespecífica)

Sistema inmunitario. respuesta inmune elementos extraños (antígenos) respuesta celular: respuesta humoral: inespecífica) Sistema inmunitario. La respuesta inmune es el conjunto de fenómenos mediante los cuales el sistema inmune reconoce los elementos extraños (antígenos) al organismo para destruirlos mediante la acción de

Más detalles

MÉTODOS CROMATOGRÁFICOS: 1. Exclusión molecular 2. Intercambio iónico 3. Afinidad SSN

MÉTODOS CROMATOGRÁFICOS: 1. Exclusión molecular 2. Intercambio iónico 3. Afinidad SSN MÉTODOS CROMATOGRÁFICOS: 1. Exclusión molecular 2. Intercambio iónico 3. Afinidad SSN Propiedades de una proteína que son útiles para su purificación por cromatografía Peso molecular Carga iónica Hidrofobicidad

Más detalles

Llamas. contra. el rotavirus humano

Llamas. contra. el rotavirus humano 210 ACTUALIDAD EN I+D RIA / Vol. 38 / N.º3 Llamas contra el rotavirus humano Investigadores argentinos descubrieron una novedosa manera de combatir esta enfermedad diarreica que afecta principalmente a

Más detalles

FISIOLOGÍA GENERAL Jesús Merino Pérez y María José Noriega Borge

FISIOLOGÍA GENERAL Jesús Merino Pérez y María José Noriega Borge REPLICACIÓN DEL ADN INTRODUCCIÓN La unidad básica de información en los seres vivos es el gen, definido en células eucariotas como un segmento de ADN que lleva la información necesaria para la síntesis

Más detalles

Dra. Patricia María O Farrill Romanillos R3AIC México, D.F. a 21 de Junio del 2012

Dra. Patricia María O Farrill Romanillos R3AIC México, D.F. a 21 de Junio del 2012 Dra. Patricia María O Farrill Romanillos R3AIC México, D.F. a 21 de Junio del 2012 Moléculas cuya función específica es la presentación de antígenos a los linfocitos T A través del receptor de linfocitos

Más detalles