Investigación traslacional en vías de transducción. Miguel Quintela-Fandino, MD, PhD, M.Sc. 26 de octubre de 2012 Simposio SEOM

Transcripción

1 Investigación traslacional en vías de transducción Miguel Quintela-Fandino, MD, PhD, M.Sc. 26 de octubre de 2012 Simposio SEOM

2 Guión Porqué éinvestigar en señalización ñli ió en clínica Retos de muestreo para estudios traslacionales Metodología básica Preclínica Ejemplo aplicación clínica Linea de investigación ió en marcha

3 Porqué señalización? Fenotipo tumoral complejo y no explicable, incluso en casos de oncogenic addiction, por un sólo factor Plataformas highthroughput estudian el estado global de una capa de regulación El comportamiento tumoral en un momento dado es el comportamiento emergente del cross talk de las distintas capas. Los efectores son las proteínas

4 Porqué señalización? Pero las proteínas... Efectores de los procesos input output La información es más cercana al fenotipo Proveen información biológica pueden desarrollarse factores predictivos multifactoriales Pero además, podemos intervenir físicamente en ellas: modificaciones post traduccionales

5 Porqué señalización? Capa fosfoproteómica Además de clasificar, intervenir

6 Retos muestreo situaciones Cantidad dilimitada it de muestra. Muestra bien conservada. Proceso de extracción y conservación constante. Tipo de estudios a realizar idealmente pre planeados. planeados. Muestra informativa. Obtención repetida en el tiempo para cambios dinámicos/adaptativos: eliminación i ió de snapshot view.

7 Determinantes de rendimiento de muestra disponible Estabilidad DNA RNA/CDNA (p)prot S Cant. Tej. DNA RNA/CDNA (p)prot S Reproduc. DNA(Seq.) RNA/CDNA (p)prot S Coste (all) DNA RNA/CDNA Seq. (p)prot S Informativ.???? (p)prot S

8 < 1 hora Congelado nitrógeno líquido Estudios masivos Proteómica Genómica Procesado rápido Sólo parafina TMA Otros Procesado habitual Sólo diagnóstico

9 Metodología básica RSRKACCAKRBIISCSPCASSKSGGTSTSYSC SCS C SS SGG S S SC AKRBIISCSPC RSRKACC ASSKSGGTSTSYSC TRYPSIN PROTEOME > UNIQUE PEPT. Shotgun

10 What happens with phospho? RSRKACCAKRBIISCSPCASSKSGGTSTSYSC P Phosphorylation: M/Z changes can be identified 1(Y) Phospho enrichment 200 (T) 1800 (S) (non P) Stochastic detection

11 What about quantitation? Isobaric Tag for Relative and Absolute Quantitation (covalent bound) 8 plex Tag 112da Tag 113da Peptide from actin, sample 1 Peptide from actin, sample 2

12 Necesario, porque dos carreras independientes no son comparables Sequence: SSGsPYGGGYGSGGGSGGYGSR, S4-Phospho ( Da) ) Inte ensity counts (10^3) FTMS, HCD, Precursor: z=+2, Mono m/z= Da, MH+= Da, Integration=Most Confident Centroid, Integration tolerance=10 ppm b 4+ -P m/z counts (10^3) 30 [M+2H]² + -P Intensity y y b b 1+ -H?O b b y y b 5+ -P y y y y 15 + y y y b 13+ -P y y 18+ -NH? y 20+ -P y 21+ -P m/z

13 Ejemplo preclínico angiogénesis Tumografts GEMMs Lack kimmune system Preserved dimmune system Growth kinetics central Spontaneous carcinogenesis necrosis andangiogenesis angiogenesis waves Cross species stroma Endogenous stroma Cheap and fast Slow, very expensive

14 Model characterization FVB MMTV PyMT Luminal B Like Her2 BRL ZR BRL BRL T47D MCF kda ER PR 81 kda Tubulin Tubulin Tubulin Ki67 inde ex ,00 TUMOR VOLUME ,00 TUNEL 0 T0 T1W T6W , Size (mm3) 800,00 600,00 200,00 0,00 200,00 w1 w2 w3 w4 w5 w6 w7 w8 w9 w10 w11 w12 w13 w14 w15 Week 0 T0 T1W T6W

15 Growth delay 3000,00 Tumor growth (volume) ze (mm3) Si 2500, , , ,00 Vehicle BIBF 1120 (85) B20 500,00 0, Weeks of treatment Weeks of treatment Vehiculo B BIBF

16 Functional analysis with Perseus V0 V_T1 V_END BIBF_T1 BIBF_END B20_T1 B20_END R PROTEIN SEQ DOM RNA BP ,4 1305, ,16 154,23 709,16 338,71 R R Titin 3179,8 419,39 197, ,4 166, ,5 429,97 SFRALLAEPK NKVSGSPEQ DDYSSGRQE ALG EIEEEYEISRR AQRESSSSVS RLLRRRRSLS!!

17 Consensus Domains are Relaxed

18 In other words Peptide Putative kinases RNA BP 45 b-adrenergic Receptor kinase SFRALLAEPKNKVSGSPEQDDYSSGRQEALG substrate motif;casein Kinase I substrate motif;casein Kinase II substrate motif;pka kinase substrate motif;pkc kinase substrate motif Titin Casein Kinase I substrate EIEEEYEISRRAQRESSSSVSRLLRRRRSLS motif;casein kinase II substrate motif;casein Kinase II substrate motif;erk1,2 Kinase substrate motif;g protein-coupled receptor kinase 1 substrate motif;gsk- 3, ERK1, ERK2, CDK5 substrate motif;pka kinase substrate motif;pkc kinase substrate motif;ww domain binding motif The phosphorylation status of a given domain is the result of the actions of many kinases we can track this back and find enrichments within clusters with significant FDR

19 BIBF end BIBF T1 T0 Cluster 745

20 1,5 GSK 3, CDK5 substrate motif BIBF1120 Protein kinase C binding protein 1 G patch domain containing protein 8 1 Likely orthologue of family with sequence similarity 104, member A Likely orthologue of family with sequence similarity 104, member A Thyroid hormone receptor associated protein 3 0,5 Peptidyl prolyl cis trans isomerase G RNA binding protein 45 Partitioning defective 3 homolog 0 V0 V1 V_1 t1 T V_end d Transcriptional repressor NF X1 Prelamin A/C;Lamin A/C Scaffold attachment factor B1;Scaffold attachment factor B2 Coiled coil domain containing protein 6 0,5 MCG18410, isoform CRA_a Serine/arginine repetitive matrix protein 1 Serine/arginine repetitive matrix protein 1 1 Serine/arginine repetitive matrix protein 1 Serine/arginine i i repetitive matrix ti protein 1 Serine/arginine repetitive matrix protein 1 1,5 Serine/arginine repetitive matrix protein 1 Cluster ID Type Name P value Enrichment Total In cluster Cluster size Benj. Hoch. FDR 730Motifs GSK 3, ERK1, ERK2, CDK5 substrate motif Motifs WW domain binding motif Motifs ERK1,2 Kinase substrate motif

21 Aplicación como estrategia terapéutica BIBF BIBF + GSK3B inh 600 BIBF BIBF + BEZ T0 T1 T3 T4 T5 T7 T8 T9 T10

22 Ejemplo : caso clínico leucemia mieloide aguda refractaria -Patient with point mutation in juxtamembarne domain of the receptor FLT3 -Received sorafenib treatment (total 10 rounds) -Blasts were isolated: before treatment after 5 th round after 10 th round after 2 months of sorafenib treatment - Control group were patients that have a duplication of tandem repeat in the same region of the receptor FLT3 AIM - Phoshoproteomic profiling of case study patient before and after receiving sorafenib treatment to indentify differently phoshorilated kinase pathways involved in response to therapy.

23

24 Leukemia samples: 1 Control & 1 Treatment Patient after 10 days Pre Post ERK FGFR3 Limitación: Número de péptidos Pre Ciclo 5 Ciclo dovitinib Blastos 36% 3% 17% 7%

25 Proyecto en marcha: factores predictivos, nuevas dianas

26 Sumario La investigación traslacional en señalización es compleja a nivel técnico y de conservación de muestra El estudio fosfoproteómico a gran escala permite interpretar el fenotipo tumoral con poco ruido de fondo Este tipo de estudios tiene aplicaciones mecanísticas, predictivas i y terapéuticas

27 Agradecimientos

28