CARACTERIZACIÓN MOLECULAR DE LOS GENES HSP70,

Transcripción

1 CARACTERIZACIÓN MOLECULAR DE LOS GENES HSP70, -tubulina y ND8 DE Leishmania braziliensis Y DETECCIÓN DE FACTORES PROTEICOS ASOCIADOS A LA REGULACIÓN DE LOS GENES HSP70 CESAR AUGUSTO RAMÍREZ SEGURA APROBADO Concepción J. Puerta Directora Manuel Soto Jurado Manuel A. Patarroyo Jurado Marcel Marín Villa Jurado Patricia Cuervo E. Jurado Gustavo Adolfo Vallejo Jurado Ingrid Schuller Ph.D. Decana Académica. Facultad de Ciencias Manuel Antonio Franco MD PhD Director de Posgrado. Facultad de Ciencias

2 PONTIFICIA UNIVERSIDAD JAVERIANA FACULTAD DE CIENCIAS PROGRAMA POSTGRADO CARACTERIZACIÓN MOLECULAR DE LOS GENES HSP70, -tubulina y ND8 DE Leishmania braziliensis Y DETECCIÓN DE FACTORES PROTEICOS ASOCIADOS A LA REGULACIÓN DE LOS GENES HSP70 CESAR AUGUSTO RAMIREZ SEGURA Directora Concepción Judith Puerta Bula PhD. Asesor José María Requena Rolanía TESIS Presentada como requisito parcial para optar al título de DOCTOR EN CIENCIAS BIOLOGICAS. Bogotá, D.C Julio de 2012

3 NOTA DE ADVERTENCIA La universidad no se hace responsable por los conceptos emitidos por sus alumnos en sus trabajos de tesis. Solo velará por que no se publique nada contrario al dogma y a la moral católica y porque las tesis no contengan ataques personales contra persona alguna, antes bien se vea en ellas el anhelo de buscar la verdad y la justicia. Artículo 23 de la resolución Nº 13 de julio de

4 AGRADECIMIENTOS A toda mi familia, por creer en mí y apoyarme en todo momento, saber que los tengo y que puedo confiar en ellos me impulsa a continuar. A Colciencias por la financiación del proyecto: Caracterización de factores asociados a secuencias reguladoras de la expresión de la proteína de choque térmico de 70 kda (HSP70) de Leishmania braziliensis No N y la financiación de mis estudios de Doctorado. A la Pontificia Universidad Javeriana por la financiación del proyecto: Caracterización de la expresión de los genes alfa tubulina de Leishmania braziliensis No SK A mi director de tesis, la Doctora Concepción J. Puerta B. también director del laboratorio de Parasitología Molecular de la PUJ. Por su orientación y apoyo en el desarrollo del proyecto. A todos los integrantes del laboratorio de parasitología molecular de la PUJ. A la Doctora Janneth González del laboratorio de Bioquímica estructural y computacional. Al Doctor Francisco Bolas director de los laboratorios de Inmunobiología e Inmunomodulación Parasitaria, de la Facultad de Farmacia de la Universidad Complutense de Madrid (España). A la Doctora María Auxiliadora Dea del Departamento de Farmacia, Facultad de Ciencias de la Salud, Universidad CEU-Cardenal Herrera. Al Doctor José María Requena director del grupo de Regulación de la Expresión Génica en Leishmania del Centro de Biología Molecular Severo Ochoa, de la Universidad Autónoma de Madrid España. 4

5 A mis amigos y a todas las personas que de una u otra manera contribuyeron con mi proceso de formación y al desarrollo de este trabajo. 5

6 TABLA DE CONTENIDO 1. RESUMEN ABSTRACT INTRODUCCIÓN MARCO TEÓRICO Epidemiologia y aspectos relevantes en la transmisión y control de las leishmaniasis Situación de la leishmaniasis cutánea en América Latina Insectos vectores Reservorios domésticos y silvestres Ciclo de transmisión Formas clínicas Diagnóstico Tratamiento Generalidades del parásito Leishmania Taxonomía Ciclo de vida Genética y biología molecular de Leishmania Genoma nuclear Regulación de la expresión génica Regulación a nivel del procesamiento y maduración de los ARNm Regulación a nivel de la estabilidad de los ARNm Regulación a nivel de la eficiencia de la traducción Genoma mitocondrial y edición del ARN Proteína de choque térmico de 70 kda (HSP70) tubulinas Subunidad 8 de la nicotinamida adenín dinucleótido ubiquinona oxidoreductasa (ND8) JUSTIFICACIÓN

7 6. OBJETIVOS Objetivo general Objetivos específicos Objetivo específico Objetivo específico Objetivo específico MATERIALES, MÉTODOS Y RESULTADOS Objetivo específico Objetivo específico Objetivo específico Artículo No. 1 Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization Artículo No. 2 Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression Artículo No. 3 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis, comparación con otros tripanosomátidos Artículo No. 4 Evidence of RNA editing in Leishmania braziliensis promastigotes Artículo No. 5 Identification of HSP70-RNA messenger interacting proteins in Leishmania braziliensis DISCUSIÓN GENERAL Organización genómica Genes nucleares Gen mitocondrial Estructura y expresión de los ARNm Genes nucleares Gen mitocondrial Regulación de la expresión génica y factores proteicos asociados a las UTR de los genes HSP70 de L. (V.) braziliensis PRINCIPALES HALLAZGOS CONCLUSIONES

8 11. PERSPECTIVAS REFERENCIAS ANEXOS ANEXO 1. FIGURAS SUPLEMENTARIAS ARTICULO No ANEXO 2. FIGURAS SUPLEMENTARIAS ARTICULO No ANEXO 3. FIGURAS SUPLEMENTARIAS ARTICULO No ANEXO 4. POSTER: Evento: XIV Congreso Colombiano de Parasitología y Medicina Tropical ANEXO 5. POSTER: Primer Congreso Colombiano de Biología Computacional ANEXO 6. POSTER: XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL ANEXO 7. POSTER: I Jornada de Investigaciones Grupo de Enfermedades Infecciosas, Facultad de Ciencias PUJB ANEXO 8. RESUMEN: XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL ANEXO 9. RESUMEN: XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL ANEXO 10. RESUMEN: II Jornada de Investigaciones Grupo de Enfermedades Infecciosas, Facultad de Ciencias PUJB ANÁLISIS PRELIMINAR DE SECUENCIAS, ESTRUCTURAS 2D Y 3D DE PROTEÍNAS PREVIAMENTE CONOCIDAS COMO HIPOTÉTICAS

9 LISTA DE ABREVIATURAS Y SIMBOLOS ADN ADNc ADNk PCR RFLP ARN ARNm ARNi ARNg ARNr ARNdc ARNpol II SL LC LCA LCL LR LD LM Ácido desoxirribonucleico. ADN copia. ADN del kinetoplasto. reacción en cadena de la polimerasa Polimorfismos en longitud de los fragmentos de restricción Ácido ribonucleico. ARN mensajero. ARN de interferencia ARN guías ARN ribosomales ARN de doble cadena ARN polimerasa II Secuencia líder leishmaniasis cutánea leishmaniasis cutánea Americana leishmaniasis cutánea localizada leishmaniasis cutánea recidiva leishmaniasis diseminada leishmaniasis mucosa 9

10 LMC LV LCD PGC UTR CPB CAT kda mg g HSP70 HSP83 MSPL CHX PFR2 PRE RPS12 CyB COI COII leishmaniasis mucocutanea leishmaniasis visceral leishmaniasis cutánea difusa grupos de genes policistrónicos secuencias transcritas pero no traducidas cisteín proteasa B cloranfenicol acetiltransferasa kilodalton miligramos microgramos proteína del choque térmico de 70 kda proteína del choque térmico de 83 kda principal proteasa de superficie cicloheximida paraflagellar rod elemento regulador de PFR proteína ribosomal S12 apocitocromo b citocromo C oxidasa subunidad I citocromo C oxidasa subunidad II 10

11 COIII NADH ND MURF CAD ATP ADP PFE CoQ pb aa DIRE SIDER SLACS CZAR TATEs citocromo C oxidasa subunidad III Nicotinamida adenín dinucleótido subunidad de la nicotinamida adenín dinucleótido deshidrogenasa marcos abiertos de lectura del maxicírculo ADNasa activada por caspasas Adenosín trifosfato Adenosín difosfato electroforesis de campo pulsado coenzima Q pares de bases aminoácidos degenerate ingi/l1tc-related elements Short Interspersed Degenerated Retroposons Spliced Leader Associated Conserved Sequence cruzi-associated retrotransposon elementos transponibles asociados a telómeros 11

12 RESUMEN 1. RESUMEN Leishmania es el agente etiológico de la leishmaniasis, entidad caracterizada por un amplio espectro de manifestaciones clínicas incluyendo afecciones cutáneas, mucocutáneas y viscerales. En el mundo, más de 350 millones de personas están en riesgo de contraer leishmaniasis y anualmente se reportan 2 millones de casos nuevos. En América Latina, la leishmaniasis es endémica en 22 países, siendo Leishmania Viannia braziliensis el principal agente causante de la leishmaniasis mucocutánea. En su ciclo de vida, Leishmania se expone a diversas temperaturas y recursos nutricionales que inducen cambios en su expresión génica, necesarios para adaptarse al nuevo ambiente. Así, durante la transición de promastigote (insecto-vector) a amastigote (hospedero mamífero), se requiere de la actividad chaperona de la proteína de choque térmico de 70 kda, de la modulación de la expresión de componentes del citoesqueleto como las -tubulinas y de la actividad oxido-reductasa de enzimas como la subunidad 8 de la nicotinamida adenín dinucleótido deshidrogenasa (ND8). Dado que la regulación de la expresión génica en tripanosomátidos opera a nivel post-transcripcional, el conocimiento de la arquitectura genómica es vital para entender los mecanismos de control génico. En este trabajo, mediante ensayos de Southern blot, Northern blot y RT-PCR se determinó la organización y expresión de los genes HSP70, -tubulina y ND8 de L. (V.) braziliensis. En primer lugar, se encontró la existencia de dos tipos de genes HSP70, los cuales difieren únicamente en su región 3 no traducida (3 UTR). Así, existen 6 copias del gen HSP70-I y una única copia del gen HSP70-II, localizada al final del tándem en el cromosoma 28. Llamativamente, los niveles de ambos tipos de ARNm no se afectan por el choque térmico. Hallazgos que sugieren la existencia de control traduccional que regule el aumento de la proteína bajo condiciones de choque térmico. En relación a los genes -tubulina, se encontraron al menos 8 copias 12

13 RESUMEN dispuestas en tándem (cromosoma 13), siendo, al igual que para los genes HSP70, el último gen divergente en su región 3 UTR. De interés, la abundancia de los mensajeros -tubulina disminuye a 35 C, efecto dependiente de la síntesis proteica. Consecuentemente, se postula la existencia de un factor proteico implicado en la desestabilización de estos mensajeros. Del gen ND8, se determinó su presencia en los maxicírculos del parásito y si bien se logró confirmar su expresión, solo se detectaron transcritos parcialmente editados correspondientes o bien a transcritos inmaduros de las proteínas mitocondriales canónicas no funcionales o a transcritos con un patrón alterno de edición. De resaltar, se reportó por vez primera, la edición del ARNm en L. (V.) braziliensis. Dado que la regulación post-transcripcional ocurre a través de interacciones entre factores proteicos y elementos ubicados en las regiones 5 UTR y 3 UTR del ARNm, se procedió a la identificación de proteínas de unión a las UTR de los mensajeros HSP70. Lo anterior, con el fin de contribuir al descubrimiento de nuevas dianas para el diseño de fármacos. Así, mediante ensayos de pull down combinados con proteómica se identificaron 52 proteínas. Algunas de éstas, como los factores de elongación 1 y 2, los putativos factores de iniciación 3.k, 4, 5 y las proteínas putativas de unión a poli-(a) 2 y 3, se relacionan con el metabolismo del ARN y la traducción de proteínas. También, se identificaron proteínas, hasta ahora reportadas como hipotéticas, que presentan motivos de unión a ARN. Otras proteínas aparentemente no relacionadas con el metabolismo del ARN, también fueron identificadas, las cuales pueden corresponder a proteínas inespecíficas (resultado del ruido de fondo de la técnica) o a proteínas que de forma similar a las denominadas moonlight cumplen distintas funciones dependiendo de su localización celular. En conclusión, se identificaron diversas proteínas que de acuerdo con su blanco y temperatura, constituyen un punto de partida para estudiar su participación en la expresión de los genes HSP70-I y II de L. (V.) braziliensis y por ende, en la virulencia y supervivencia del parásito en el hospedero mamífero. 13

14 ABSTRACT 2. ABSTRACT Leishmania is the etiologic agent of the leishmaniasis, characterized for a broad spectrum of clinical manifestations including cutaneous, mucocutaneous and visceral manifestations. More than 350 million people are at risk of contracting leishmaniasis around the world and yearly are reported 2 million of new cases. In America Latina, the leishmaniasis is endemic in 22 countries, being Leishmania Viannia braziliensis the main causative agent of the mucocutaneous leishmaniasis. In its life cycle, Leishmania is exposed at several temperatures and nutritional sources which induce changes in its genetic expression, required for adaptation to the new environment. Thus, during the transition of promastigote (insect vector form) to amastigote (mammalian host form), are required the chaperone activity of the 70 kda heat shock protein (HSP70), modulation of the expression of cytoskeletal components as -tubulin and oxidoreductase activity of the mitochondrial enzymes as nicotinamide adenine dinucleotide dehydrogenase subunit 8 (ND8). Since the regulation of genetic expression in trypanosomatids operates at the posttranscriptional level, the knowledge of the genomic architecture is basic to understand the genetic control mechanism. In this work, through southern blot, northern blot and RT-PCR assays the organization and expression of the HSP70, -tubulin and ND8 genes from L. (V.) braziliensis was determined. First, it was found that there are two types of HSP70 genes, which differ only in its 3 untranslated region (3 UTR). Thus, there are 6 copies of HSP70-I gene and only one copy of HSP70-II gene, the latter localized at end of the tandem on chromosome 28. Strikingly, the levels of both types of mrnas do not are affected by heat shock. Findings that suggest the existence of a control at the translational level, regulating the gain of protein under heat shock condition. In regard to the - tubulin genes, as for HSP70 genes, there exist several copies tandemly organized and the last gene has a divergent 3 UTR. Of interest, the abundance of -tubulin 14

15 ABSTRACT messenger s decreases when parasites are incubated at 35 C, and this effect was found to be dependent on protein synthesis. Consequently, it was postulated the existence of a protein factor implicated in destabilizing these messengers. Of ND8 gene, it was determined its presence in the parasite maxicircles and evidence of its expression was obtained; however, only partially edited transcripts, corresponding to immature transcript, or transcripts with alternative edition pattern were detected. Of note, it was reported for the first time the mrna editing in L. (V.) braziliensis. Since posttranscriptional regulation occurs through interactions between protein factors and elements on 5 and 3 UTR, we proceeded to the identification of UTR-binding proteins with affinity to the HSP70 messenger. Thus, through pull down assays combined with proteomic approaches, 52 proteins were identified. Some of these, as elongation factor 1a and 2, the putative initiation factors 3.k, 4a and 5, the putative poly A binding proteins 2 and 3, are related to RNA metabolism and protein translation. Also proteins until now annotated as hypothetical were identified in L. (V.) braziliensis protein extracts; remarkably, they contains RNA binding motifs. Other proteins apparently no related to RNA metabolism also were identified. At present, we do not know whether they correspond to unspecifically bound proteins or they are moonlight proteins, which meet different functions depending of its cellular location. In summary, several proteins were identified on the basis of their specific RNA association and their dependence on the parasite growth temperature. This work represents a starting point for future studies leading to analyze their participation in the regulation of gene expression of HSP70-I and II genes from L. (V.) braziliensis, and hence in virulence and survival of parasite on mammalian host. The knowledge derived from these studies will lead to the discovery of new targets for designing of more efficient drugs against leishmaniasis. 15

16 INTRODUCCIÓN 3. INTRODUCCIÓN Leishmania es el agente etiológico de la leishmaniasis, parasitosis que abarca distintas manifestaciones clínicas que incluyen desde lesiones cutáneas de auto curación (LC), lesiones mucosas (LM), lesiones mucocutáneas (LMC) necrotizantes, lesiones nodulares múltiples en piel conocidas como leishmaniasis cutánea difusa (LCD) hasta afecciones viscerales (LV), frecuentemente de evolución fatal (1). Más de 350 millones de personas se consideran en riesgo de contraer leishmaniasis en 98 países de los 5 continentes y anualmente se reportan alrededor de 2 millones de nuevos casos (2). En América Latina, la LC y LMC constituyen un problema de salud pública descuidado, endémico en 22 países, en donde las especies del subgénero Leishmania Viannia causan la mayoría de casos de LC, siendo L. (V.) braziliensis el principal agente etiológico de la LMC (3). Los antimoniales pentavalentes constituyen el tratamiento convencional contra la leishmaniasis (4), seguido por anfotericina B, paromomicina, pentamidina y miltefosina. Sin embargo, la elevada toxicidad y el incremento en los casos de resistencia frente a su uso (5), aparte de otras consideraciones como el costo y la disponibilidad en el caso de la anfotericina B y la miltefosina (6-8), plantean la necesidad urgente de nuevos enfoques terapéuticos basados en el descubrimiento de nuevos blancos parasitarios (5, 7, 9). Durante su ciclo de vida, las especies de Leishmania que infectan al hombre alternan entre dos organismos y están expuestas a ambientes altamente variables y hostiles: Así en el insecto vector poiquilotermo los parásitos se exponen a temperaturas de 22 a 28 C, mientras que en sus hospederos mamíferos se enfrentan a temperaturas de 35 a 37 C. Adicionalmente, al interior de los macrófagos, las células del hospedero que son blanco de la infección, el parásito está sometido a un ph ácido, a nuevas fuentes nutricionales y condiciones de óxido-reducción (10). 16

17 INTRODUCCIÓN El cambio de temperatura, de ambiente oxido-reducción y de recursos nutricionales causados por la entrada en hospederos mamíferos, desencadena una serie de respuestas adaptativas a nivel de la expresión génica del parásito (11), que responden a necesidades específicas como: I) prevenir la generación de proteínas disfuncionales debido al estrés térmico, donde la proteína del choque térmico de 70 kda (HSP70) juega un papel central como chaperona contribuyendo con la generación de proteínas correctamente plegadas; II) responder a los cambios morfológicos que debe sufrir el parásito en la transformación de promastigote a amastigote, proceso que es dependiente de componentes básicos del citoesqueleto como las -tubulinas y III) afrontar el desafío que representa la supervivencia y la reproducción en las células del hospedero, adaptando su metabolismo energético al uso de nuevos recursos nutricionales y condiciones de óxido-reducción, en donde se pueden encontrar implicadas diferentes subunidades y componentes de la cadena respiratoria mitocondrial como el gen de la subunidad 8 de la nicotinamida adenín dinucleótido deshidrogenasa (ND8). Por otro lado, debido a la falta de promotores para la ARNpol II en tripanosomátidos, los genes se transcriben constitutivamente como grupos de genes policistrónicos (PGC por su sigla en inglés) (12, 13). Así, el control de la expresión génica en Leishmania depende de mecanismos post-transcripcionales relacionados con el procesamiento, estabilidad y traducción del ARNm. Por lo anterior, el entendimiento de la regulación génica en tripanosomátidos parte del conocimiento de la organización genómica de los genes de interés. Si bien el genoma de L. (V.) braziliensis se encuentra disponible, este no incluye la determinación de las secuencias transcritas pero no traducidas (UTR) y en el caso de genes repetidos como los genes HSP70 y -tubulina, el número de copias suele ser impreciso debido a la dificultad que representa ensamblar secuencias repetidas. Adicionalmente, el genoma ensamblado solo incluye secuencias nucleares, dejando excluidos genes mitocondriales como el ND8. 17

18 INTRODUCCIÓN En relación a los genes HSP70, en otras especies de Leishmania se conoce que éstos se organizan en tándem y que existen dos tipos de genes que se diferencian únicamente en su región 3 UTR (HSP70-I y HSP70-II), sin embargo, este tipo de organización hasta el momento no ha sido descrita para L. (V.) braziliensis (14). Con respecto a los genes -tubulina, en Leishmania major se sabe de la existencia de 12 copias localizadas en el cromosoma 13. En L. (V.) braziliensis, por ejemplo, el genoma muestra una agrupación de tan solo 3 copias (dos enteras y una truncada), delimitada en el 5 por un fragmento de longitud y secuencia desconocida que se localizan en el cromosoma 13. Una copia truncada adicional de estos genes se reporta en el cromosoma 29. En relación a los genes ND8, se conoce que en Leishmania tarentolae, Leishmania donovani, L. (L.) amazonensis y L. (L.) major, estos se localizan en los maxicírculos del genoma mitocondrial (15-19). Así, en este trabajo se determinó la organización genómica de los genes codificantes para las proteínas HSP70, -tubulina y ND8 de L. (V.) braziliensis. Dado que el conocimiento de la expresión génica es vital para entender la biología del parásito y su interacción con el hospedero, paralelamente, en este trabajo, se determinó la expresión de todos los genes en estudio en promastigotes de L. (V.) braziliensis mantenidos en condiciones normales de crecimiento y luego de exposición a choque térmico (35 C, por tratarse de una especie causante de LC y LMC). Debido a la dependencia de los mecanismos de regulación postranscripcional que tienen los tripanosomátidos, en estos parásitos se ha elucidado la existencia de factores proteicos que en conjunto con elementos reguladores situados en las regiones UTR del ARNm blanco, modulan la expresión génica en estos parásitos (11, 13, 20). Por otro lado, se ha demostrado que la proteína HSP70 de L. (L.) infantum es necesaria para la multiplicación de promastigotes en fase estacionaria y de 18

19 INTRODUCCIÓN amastigotes, tanto in vitro como in vivo (21). Es más, la deleción del gen HSP70-II disminuye la capacidad infectiva del parásito y por ende, la patología ocasionada en diferentes modelos animales (21, 22). Por tanto, dada la importancia de la proteína HSP70 para la virulencia y supervivencia del parásito, en este trabajo, se identificaron factores proteicos que interactúan con las regiones UTR de los transcritos HSP70 I y II, potencialmente implicados en la regulación de la expresión de la proteína HSP70. Conocimiento, que permitirá una mayor comprensión de los mecanismos post-transcripcionales de regulación de la expresión génica en tripanosomátidos y sentará bases para el descubrimiento de nuevas dianas para el diseño de fármacos antiparasitarios, basadas en las vías de regulación de la expresión. 19

20 MARCO TEÓRICO 4. MARCO TEÓRICO 4.1. Epidemiologia y aspectos relevantes en la transmisión y control de las leishmaniasis Los protozoos parásitos del género Leishmania (Ross, 1903) son los agentes patógenos responsables de la leishmaniasis. En la naturaleza, todas las especies de Leishmania se transmiten cuando flebótomos infectados (Diptera: Psychodidae, de los géneros Lutzomyia y/o Phlebotomus ) se alimentan de sangre, inoculando también promastigotes metaciclicos al mamífero (23). Estas parasitosis se han generalizado en todos los continentes excepto en la Antártida (1). Leishmania se encuentra en ecosistemas extremadamente diversos y es capaz de infectar una amplia variedad de mamíferos. En los seres humanos, la mayoría de las infecciones por Leishmania conducen a casos asintomáticos (1). Sin embargo, cuando la enfermedad se presenta, se expresa un conjunto de manifestaciones clínicas que incluyen desde lesiones cutáneas de auto curación (LC) hasta la mortal infección visceral (LV) (1, 24). El área de distribución de las leishmaniasis ha sido ampliamente subdividida en Nuevo Mundo (Las Américas) y Viejo Mundo (África, Asia y Europa). Las especies de Leishmania se asocian generalmente con una u otra de las dos subdivisiones. Todas las especies del subgénero Leishmania Viannia fueron aisladas en el Nuevo Mundo, mientras que la mayoría del subgénero Leishmania Leishmania se aislaron del Viejo Mundo, a excepción de las especies del complejo Leishmania (L.) mexicana, Leishmania (L.) hertigi y Leishmania (L.) deanei que se encuentran sólo en el Nuevo Mundo y Leishmania (L.) infantum que se encuentra tanto en el Viejo como en el Nuevo Mundo (1). En la Tabla 1 se resumen las especies de Leishmania que causan enfermedad al hombre y algunas de sus características. 20

21 MARCO TEÓRICO Tabla 1. Especies de Leishmania que infectan al hombre. Leishmanias del Nuevo Mundo Principal patología clínica Ciclo de transmisión L. Viannia braziliensis LC, LMC Zoonótico L. Viannia panamensis LC, LMC Zoonótico Distribución geográfica Sur América, Centro América y México Norte de Sur América y Sur de Centro América L. Viannia guyanensis LC, LMC Zoonótico Sur América L. Viannia peruviana LC Zoonótico Perú L. Viannia lainsoni LC Zoonótico Sur América L. Viannia colombiensis LC Zoonótico Norte de Sur América L. Leishmania amazonensis LC, LCD Zoonótico Sur América L. Leishmania mexicana LC, LCD Zoonótico Centro América, México y USA L. Leishmania pifanoi LC Zoonótico Sur América L. Leishmania venezuelensis LC Zoonótico Norte de Sur América L. Leishmania garnhami LC Zoonótico Sur América Leishmanias del Viejo Mundo L. Leishmania aethiopica LC, LCD Zoonótico Etiopia y Kenya L. Leishmania killicki LC Zoonótico Norte de África L. Leishmania tropica LC antroponótico Asia Central, medio Este, sur este y parte del Norte de África L. Leishmania donovani LV antroponótico África, Centro y sureste de Asia L. Leishmania major LC Zoonótico Asia Central, Norte y Este de África Leishmanias del Nuevo y Viejo Mundo Europa, Norte de L. Leishmania infantum LC, LV Zoonótico África, Centro y Sur América Adaptado de Reithinger y colaboradores, 2007 (25); Oddone y colaboradores, 2009 (3). Aproximadamente, entre 0,2 y 0,4 millones de casos de LV y 0,7 a 1,2 millones de casos de LC se producen cada año. Más del 90% de los casos mundiales de LV se producen en sólo seis países: India, Bangladesh, Sudán, 21

22 MARCO TEÓRICO Sudán del Sur, Brasil y Etiopía, registrándose de a muertes anuales (2). La leishmaniasis cutánea se distribuye más ampliamente, con cerca de un tercio de los casos producidos en cada una de las siguientes tres regiones: Las Américas, la cuenca del Mediterráneo y Asia occidental (desde el Medio Oriente hasta Asia Central). Los diez países con las estimaciones más altas de casos son: Afganistán, Argelia, Colombia, Brasil, Irán, Siria, Etiopía, Sudán del Norte, Costa Rica y Perú, representando en conjunto el 70 a 75% de la incidencia mundial estimada (2). A pesar del gran impacto que tiene a nivel mundial, la leishmaniasis es considerada como enfermedad olvidada, afectando en gran medida a la población más pobre, sobre todo en los países en desarrollo (26). Por ser L. (V.) braziliensis el objeto de este estudio, a continuación se presenta el panorama de la LC y la LMC en América Latina Situación de la leishmaniasis cutánea en América Latina En América Latina, la leishmaniasis cutánea americana (LCA) es causada principalmente por especies del subgénero Leishmania Viannia. Las especies más frecuentes son L. (V.) braziliensis, L. (V.) panamensis, L. (V.) peruviana, L. (V.) guyanensis y L. (V.) lainsoni (27, 28). En México, los agentes causantes de la LCA son L. (L) mexicana y L. (V.) braziliensis (29, 30). Esta enfermedad se ha extendido por 17 estados de México, incluyendo Campeche, Chiapas, Coahuila, Jalisco, Michoacán, Nayarit, Nuevo León, Oaxaca, Tamaulipas, Quintana Roo, Tabasco, Veracruz, Yucatán, Durango y Sinaloa. Por su parte, la LMC se ha reportado en Tabasco y Chiapas (30-33). En Venezuela, las principales especies causantes de leishmaniasis cutánea son L. (L.) mexicana y L. (V.) braziliensis (34). También se ha encontrado a L. (L) venezuelensis pero se sugiere que es una variante de L. (L.) mexicana y que la clasificación de L. (L.) venezuelensis debe ser reconsiderada (35). 22

23 MARCO TEÓRICO En Ecuador, la enfermedad es endémica en la mayoría de provincias costeras de la región Pacífica, las tierras bajas amazónicas y algunos valles interandinos. Mientras que la LC se encuentra en todo el Ecuador, la LMC parece estar restringida a la región amazónica. L. (V.) panamensis es la especie más frecuentemente identificada en la región del Pacífico y se ha asociado con varias formas clínicas de la enfermedad cutánea (LC). En el foco amazónico la leishmaniasis mucocutánea se asocia con L. (V.) braziliensis y la variante papular de LC conocida como Uta, se encuentra en el altiplano andino y se relaciona principalmente con L. (L.) mexicana (36). El 70% de la región del Perú se ve afectada por la leishmaniasis, siendo el 96% de los casos causados por tres especies: L. (V.) braziliensis, L. peruviana y L. guyanensis (28, 37). L. (V.) braziliensis predomina en casi todo el territorio de Brasil, incluyendo la región Amazónica. Algunos estudios reportan a L. (V) braziliensis Algunos en aproximadamente el 55% de los casos de leishmaniasis cutánea LC en el Amazonas y en aproximadamente el 95% de los casos de LC en el resto del país tanto en zonas urbanas como rurales (38-43). Bolivia tiene la mayor incidencia de LCA en América Latina (44), siendo endémica en seis a siete de los nueve departamentos (44, 45). Entre 2001 a 2006 se detectaron 2909 casos, de los cuales (85,5%) correspondieron a leishmaniasis cutánea localizada (LCL) y 421 (14,5%) a LMC (46). En la actualidad, la leishmaniasis muestra un patrón creciente en las tierras bajas tropicales y subtropicales que son aptas para la agricultura y la ganadería (45). Estudios previos han descrito una compleja distribución de diferentes especies de Leishmania en la zona endémica del departamento de La Paz: L. (V.) braziliensis, L. (L.) chagasi, L. (L.) amazonensis y L. (V.) lainsoni (45). En Argentina, en el año 2002 se reportaron 748 casos de leishmaniasis humana en diez provincias donde la enfermedad es endémica (tasa de incidencia 23

24 MARCO TEÓRICO 0,2 casos/ habitantes/año) y desde entonces se inició un período interepidémico con pequeños focos dispersos en toda la zona endémica ( casos). Tres especies de Leishmania se han aislado de pacientes con LCA en Argentina: L. (V.) braziliensis, L. (L.) amazonensis y L. (V.) guyanensis. De éstas, L. (V.) braziliensis ha sido el principal agente asociado con brotes de LCA y LMC (47). En Colombia, existen tres ciclos de transmisión de la leishmaniasis cutánea: la leishmaniasis cutánea zoonótica de transmisión selvática, la leishmaniasis cutánea zoonótica de transmisión peridoméstica y urbana (48). Tabla 2. Número de casos de leishmaniasis reportados en Colombia durante el período Forma clínica Años Cutánea Mucosa Visceral Tomado de Peñuela y Sánchez, 2007 (48). A continuación se citan algunos reportes de caso en el país: En el año 2004 se reportaron casos de leishmaniasis en todas sus formas; en el 2005 fueron informados casos y en el año 2006 se reportaron 8.447, de los cuales (98,2%) correspondieron a LC, ver Tabla 2 (48). En el 2008 se reportó que L. (V.) guyanensis fue el principal agente etiológico (94,6% de los casos) de una epidemia de LC en tres municipios del Tolima en el centro del país (49). En el departamento de Santander se reportaron dos casos de pacientes procedentes de zonas endémicas con LCD generados por una cepa de L. (V.) panamensis (50). En la zona urbana de Cartagena se detectó en el 2012 un caso de leishmaniasis, donde aparentemente no existían factores de riesgo (51). 24

25 MARCO TEÓRICO Tabla 3. Departamentos con mayor número de casos de leishmaniasis cutánea y mucocutánea en Colombia, semanas epidemiológicas 1 a 40 de Procedencia Leishmaniasis cutánea Leishmaniasis mucosa Antioquia Meta Guaviare Caquetá Nariño Putumayo Santander Vaupés Tomado de Boletín Epidemiológico semana 40 (52) En el año 2011 hasta la semana epidemiológica 40 se notificaron casos de leishmaniasis distribuidos así: casos de LC, 113 de LMC y 22 casos de LV. El 70% de la notificación de LC y LMC procedió de los departamentos de Antioquia, Meta, Guaviare, Caquetá, Nariño, Putumayo, Vaupés y Santander, ver Tabla 3 (52) Insectos vectores Los vectores de Leishmania son insectos pequeños del orden Diptera, que pertenecen a la subfamilia Phlebotominae, comúnmente llamados flebótomos o moscas de arena. Sólo la hembra es hematófaga ya que necesita alimentarse de sangre para completar el desarrollo de los huevos (53, 54). Las especies de flebótomos responsables de la transmisión de Leishmania varían de acuerdo con la región y pueden transmitir diferentes especies de Leishmania (55-57). De los seis géneros de flebótomos descritos, sólo dos están implicados en la transmisión del parásito: Phlebotomus del Viejo Mundo, dividido 25

26 MARCO TEÓRICO en 12 subgéneros y Lutzomyia del Nuevo Mundo, dividido en 25 subgéneros. De las 500 especies de flebotomínos conocidas, sólo 31 han sido identificadas como vectores de especies de Leishmania y 43 como probables vectores (55, 56, 58). Algunos flebótomos se consideran vectores restringidos ya que solo transmiten determinadas especies del parásito, como Phlebotomus papatasi y Phlebotomus sergenti que son los vectores de L. (L.) major (53) y Leishmania (L.) tropica, respectivamente (54). Por el contrario, otras especies como Lutzomyia longipalpis (permite el desarrollo de los subgéneros Leishmania Leishmania y Leishmania Viannia) (59), Phlebotomus argentipes (permite el desarrollo de L. (L.) donovani, L. (L.) amazonensis y L. (L.) major) (53) y Phlebotomus halepensis (permite el desarrollo de L. (L.) major y L. (L.) tropica) (60) son capaces de desarrollar infecciones transmisibles cuando se infectan con varias especies de Leishmania y son conocidos como vectores permisivos (53, 54, 60-63) Reservorios domésticos y silvestres El perro puede hospedar tanto a Leishmanias causantes de LV como a las responsables de la LC, aun en infecciones mixtas (64, 65). Otros animales domésticos como el caballo (66) y los gatos también se han encontrado infectados con Leishmania (67). En la naturaleza, pequeños mamíferos silvestres frecuentemente se encuentran infectados con parásitos del subgénero Leishmania Viannia, entre los cuales están: ratas de agua (Squamipes nectomys), ratas negras (Rattus rattus), ratones de hierba (Bolomys lasiurus), ratones de pantano (Holochilus scieurus), ratones de campo (Akodon arvieuloides), oposums lanudos (Marmosa sp.) y zarigüeyas comunes (Didelphis albiventris). Aunque muchos mamíferos se han encontrado infectados de manera natural, ninguno de los estudiados cumple completamente los requisitos para ser definido como el principal reservorio de las especies de Leishmania Viannia causantes de LCA y LMC (68). 26

27 MARCO TEÓRICO Ciclo de transmisión La mayoría de las infecciones por Leishmania son de origen zoonótico, aunque se conocen algunos casos de transmisión de L. (L.) donovani de humano a humano (1). Se reconocen 3 ciclos de transmisión diferentes: (i) un ciclo primitivo o silvestre (transmisión accidental a humanos, que se produce en focos silvestres), por ejemplo, L. (V.) braziliensis, (ii) un ciclo secundario o peridoméstico (el reservorio es un animal doméstico o peridoméstico y el parásito se transmite a los seres humanos por vectores antropofílicos), por ejemplo, L. (L.) infantum y (iii) un ciclo terciario, estrictamente antroponótico, en el que el reservorio animal ha desaparecido (o no ha sido identificado) y los insectos vectores son totalmente antropofílicos, por ejemplo L. (L.) donovani (69) Formas clínicas Las infecciones con Leishmania pueden producir una amplia gama de patologías, desde portadores asintomáticos (individuos infectados sin manifestaciones clínicas) y lesiones cutáneas de autocuración a los casos más graves, como la forma visceral. Cuando los seres humanos han sido picados por un insecto vector infectado, pueden desarrollar la leishmaniasis o no. La tasa de portadores asintomáticos, no se conoce con precisión, pero diferentes estudios han sugerido que puede ser mayor de lo esperado. Por ejemplo, en las Islas Baleares, ADN de L. (L.) infantum fue amplificado por reacción en cadena de la polimerasa (PCR) del 22% de los donantes de sangre (70). Portadores asintomáticos de especies causantes de LV se han identificado en Brasil (71), el sur de Francia (72) y la India (73). La infección subclínica con especies del subgénero Leishmania Viannia también ha sido reportada (74, 75). La leishmaniasis cutánea comprende diferentes formas clínicas que dependen de la especie de Leishmania, la cepa implicada y la respuesta del 27

28 MARCO TEÓRICO hospedero. La lesión inicial ocurre en el sitio de la picadura del vector en forma de una mácula, que a partir de 2 semanas a 3 meses en adelante se puede presentar como una pápula pequeña, pruriginosa y eritematosa o como un nódulo. La lesión también puede comprometer ganglios linfáticos de drenaje y convertirse en un granuloma más adelante que puede progresar a engrosamiento de la piel en placas (76, 77). Esta lesión puede resolverse espontáneamente o puede convertirse en una úlcera característica. Algunas lesiones pueden transformarse en otras formas crónicas de la enfermedad. Aunque hay evidencias que sugieren una correlación entre las características clínicas y las especies de Leishmania (78, 79), esta relación no está claramente definida, sobre todo en regiones en las que conviven muchas especies diferentes del parásito (76). Con base en sus diferentes presentaciones clínicas, las leishmaniasis cutáneas se clasifican como leishmaniasis cutánea localizada (LCL), leishmaniasis cutánea recidiva (LR), leishmaniasis diseminada (LD), leishmaniasis cutánea difusa (LCD), mucocutánea (LMC) y La leishmaniasis cutánea Post-kala-azar (PKDL) (76). La LCL es la forma más frecuente con 1 a 10 lesiones que se localizan en áreas expuestas del cuerpo. El tipo de lesión más común se caracteriza por ser una úlcera indolora, rosada, redonda, bien delimitada con bordes elevados, una base indurada y un fondo limpio, donde puede aparecer una costra central que sangra. Resolución espontánea, seguida de una cicatriz hipopigmentada, fina y lisa puede ocurrir en algunos casos (76). La LR, más frecuente en el Viejo Mundo, en donde es asociada a la infección por L. (L.) tropica, se caracteriza por una lesión activa en o cerca del borde de una lesión previa ya cicatrizada. Se desarrolla después de un período de tiempo variable con o sin tratamiento. En el Nuevo Mundo, la LR se asocia con L. (V.) braziliensis y L. (L.) amazonensis en Brasil (80) y L. (V.) panamensis en Ecuador (81). 28

29 MARCO TEÓRICO La LD se caracteriza por la aparición de múltiples lesiones pleomórficas (10-300) en 2 o más áreas no contiguas y expuestas del cuerpo, probablemente causadas por propagación hematógena o linfática. Las lesiones son acneiformes, ulceradas y papulares. La mucosa se ve afectada en el 29% de los casos. En Brasil, esta presentación se atribuye a L. (V.) braziliensis (82). La LCD es una forma anérgica de leishmaniasis cutánea en la cual los pacientes presentan baja respuesta inmune celular (83), por lo que las lesiones están llenas de parásitos. La LCD es una enfermedad rara que se presenta en América del Sur, América Central y Etiopía. Se desarrolla progresivamente a partir de LCL y se caracteriza por múltiples nódulos, pápulas o tubérculos con infiltración cutánea difusa sin ulceración. Se localiza principalmente en las zonas expuestas del cuerpo. Las principales especies implicadas incluyen L. (L.) mexicana y L. (L.) amazonensis en el Nuevo Mundo y L. (L) aethiopica en el Viejo Mundo (84, 85). También, se ha encontrado que L. (V.) braziliensis puede causar lesiones cutáneas diseminadas. La LM puede ocurrir simultáneamente con una manifestación cutánea (LMC), sin embargo, la LM generalmente ocurre meses o años después de la leishmaniasis cutánea. La LM afecta principalmente a la mucosa nasal y con menor frecuencia la oral. Los síntomas iniciales son inespecíficos, lo que hace difícil el diagnóstico. Los síntomas pueden incluir picazón en la nariz, que progresa a la formación de la costra y el sangrado. Inicialmente, se observa inflamación y congestión al examinar las fosas nasales, sin embargo, lentamente puede sobrevenir ulceración y perforación del tabique. Partes de la cara, el paladar, la faringe y la laringe pueden verse afectadas (86). La especie principalmente implicada en el Nuevo Mundo es L. (V.) braziliensis, aunque L. (V.) panamensis, L. guyanensis y L. (L.) amazonensis también pueden estar involucradas (28). En el Viejo Mundo, L. (L.) major y L. (L.) infantum viscerotrópica están relacionadas con LM (87). La frecuencia de LM varía en función de la ubicación geográfica. En 29

30 MARCO TEÓRICO Brasil, la incidencia puede variar de 0,4% a 2,7% (28), mientras que en los países andinos, la incidencia media es del 7,1% (88). La PKDL es una complicación de la (LV), se caracteriza por una erupción nodular, macular y maculopapular, en pacientes que se han recuperado de LV. La erupción comienza generalmente alrededor de la boca, desde donde se extiende a otras partes del cuerpo, dependiendo de la gravedad. Se ve sobre todo en Sudán y la India, limitándose en gran medida a las áreas donde L. (L.) donovani es el parásito causante de LV. El intervalo en el que la PKDL sigue a la LV es de 0-6 meses en Sudán y 2-3 años en la India. La PKDL probablemente tiene un papel importante en los periodos interepidémicos de LV, actuando como reservorio para los parásitos (89) Diagnóstico El diagnóstico de la leishmaniasis se basa en la sospecha clínica de la enfermedad, la presencia de riesgo epidemiológico y de pruebas de laboratorio positivas para la infección, donde el médico debe tener en cuenta la fiabilidad de los resultados del laboratorio (90). La caracterización de la especie del parásito responsable de la infección puede ser importante en el diagnóstico para dirigir el tratamiento adecuado (28), pues las especies de Leishmania muestran diferente susceptibilidad a los fármacos (91). Así mismo, la evolución y el pronóstico de la enfermedad también depende de la especie del parásito (28). Por ejemplo, los pacientes infectados con L. (V.) braziliensis tienen un riesgo más alto de desarrollar LMC (92). Debido a su alta especificidad, el diagnóstico parasitológico es el gold standard en el diagnóstico de la leishmaniasis cutánea. Entre las técnicas empleadas para hacer diagnostico parasitológico están: El examen microscópico de frotis, de biopsias o aspirados teñidos con Giemsa, el examen histopatológico de biopsias 30

31 MARCO TEÓRICO de lesiones y el cultivo de aspirados o biopsia triturada (93). De éstos, el más comúnmente usado es el examen microscópico. El método de cultivo, seguido de la caracterización de especie por isoenzimas o anticuerpos monoclonales es probablemente el más informativo, ya que permite la identificación y caracterización de especies, sin embargo, requiere de mayor infraestructura, conocimientos y tiempo. La sensibilidad de todas estas técnicas, sin embargo, tiende a ser baja y puede ser muy variable, dependiendo del número de parásitos, la dispersión de estos en la muestra de biopsia, los medios de cultivo y la experticia del operario entre otros (25). Las pruebas serológicas y la prueba cutánea de la leishmanina (LST) han sido utilizadas como herramientas de diagnóstico rutinario, pero no distinguen entre infecciones actuales y pasadas y su especificidad es baja en las zonas endémicas (28). Por lo anterior, se han desarrollado una gran variedad de pruebas moleculares dirigidas a optimizar el diagnóstico de la leishmaniasis. Por ejemplo, los métodos de PCR basados en la detección de ADN del kinetoplasto (ADNk) son muy sensibles debido a la presencia de miles de copias de estas secuencias en el parásito. La PCR parece ser una herramienta valiosa para el diagnóstico de la leishmaniasis, que además puede proporcionar información epidemiológica valiosa sobre la enfermedad en los países en donde es endémica (94). Así, en el 2002, en el estado de Pernambuco (Brasil), se mostró que los métodos basados en la PCR a partir de muestras de biopsias cutáneas, fueron significativamente superiores en cuanto a sensibilidad (88,2-95,4%) y especificidad (100%) comparados con el examen de frotis, tinción histológica y el aislamiento por cultivo (95). En el 2003, en Bahía (Brasil) se estudió la utilidad de la PCR para el diagnóstico de LC, en un área donde L. (V.) braziliensis es endémica. El ADN de Leishmania se detectó en 50 casos, con una tasa de positividad del 100%, superior a la encontrada por todos los otros métodos de diagnóstico estudiados (prueba de Montenegro, pruebas serológicas y examen microscópico de biopsia de lesión) (96). En Sao 31

32 MARCO TEÓRICO Paulo (Brasil) en el 2008, se evaluó la utilidad de iniciadores diseñados para amplificar una región de la secuencia líder derivada del gen mini-exon (SL), en la detección del complejo L. (V.) braziliensis en biopsias, demostrando tener una mayor sensibilidad que los métodos convencionales (97). Variaciones de la PCR como el método PCR-RFLP (Polimorfismos en longitud de los fragmentos de restricción), ha sido aplicado en biopsias para diagnosticar e identificar L. (V.) braziliensis y L. (L.) amazonensis con un alto valor de concordancia ( = 91.5%) con respecto a la hibridación molecular, presentando potencial importancia para el diagnóstico y la identificación de Leishmania en muestras clínicas, reservorios y vectores infectados (98) Tratamiento El arsenal quimioterapéutico actual contra la leishmaniasis consiste en moléculas que incluyen el antimonio pentavalente, medicamento usado desde 1924, la pentamidina, diversas formulaciones del antibiótico anfotericina B y más recientemente, la miltefosina (99-101). Desafortunadamente, la elección del tratamiento en lugar de obedecer a indicaciones terapéuticas racionales, a menudo se debe a consideraciones económicas (102). Por lo anterior, en la gran mayoría de los países afectados, los enfoques quimioterapéuticos para todas las formas de leishmaniasis se basan en el uso de antimoniales pentavalentes. El desarrollo de antimoniales pentavalentes menos tóxicos en la década de 1920 por Brahmachari, Schmidt, Kikuth y otros llevó a la síntesis de gluconato de antimonio (Solustibosan ) en 1937 y estibogluconato de sodio (Pentostam ) en 1945 (103). Más adelante, el antimoniato de meglumina (Glucantime ) fue desarrollado por Aventis (Francia). Así, los antimoniales pentavalentes Pentostam (GlaxoSmithKline, Reino Unido) y Glucantime, siguen siendo los tratamientos de primera línea para LV y algunas formas de LC (104, 105). 32

33 MARCO TEÓRICO Antimoniales genéricos también han sido analizados mostrando que estos también pueden ser eficaces (106). La falla terapéutica causada por diversos factores, como la generación de resistencia por parte del parásito durante el tratamiento con antimonio es un problema bien conocido (5). Otros factores que conducen a la falla terapéutica son: factores relacionados con el hospedero (la inmunosupresión por VIH o desnutrición), el fármaco (la calidad del lote o medicamentos falsificados), la especies de Leishmania implicadas (91) o el seguimiento incompleto del tratamiento por falta de adherencia o tolerancia (6-8, 107, 108). La anfotericina B (amp B) es un antibiótico macrólido polienico aislado de Streptomyces nodosus. Su actividad anti-leishmanial se reportó desde 1960 y pronto fue utilizado en el tratamiento de la leishmaniasis mucocutánea ( ). La amp B se utiliza predominantemente como un fármaco antifúngico, específicamente para el tratamiento de micosis sistémicas. La actividad selectiva de la anfotericina B contra hongos y Leishmania se debe a la mayor afinidad del fármaco por los esteroles que se encuentran en la membrana plasmática de estos microorganismos. Aunque la amp B ha sido considerada como una alternativa de tratamiento para la leishmaniasis mucocutánea y visceral (4), su uso se ha visto limitado por los efectos secundarios tóxicos que presenta, en particular, cardiotoxicidad y nefrotoxicidad (112). La formulación estándar que se utiliza en el tratamiento es la anfotericina B desoxicolato (Fungizone ), una dispersión coloidal tensioactiva disponible para la administración intravenosa. Las dificultades que ha demostrado el tratamiento de la LMC (113) y los problemas cada vez mayores de resistencia al antimonio en los casos de LV han llevado a un renovado interés en el fármaco (4). La pentamidina, una diamidina aromática, como la sal de isetionato (Pentacarinat ) y anteriormente la sal de metilsulfonato (Lomidine ), se ha utilizado como tratamiento alternativo tanto para LV como para LC desde 1952, 33

34 MARCO TEÓRICO tratamiento primario para LCD causada por L. (L) aethiopica y como fármaco de segunda línea para casos de resistencia a los antimoniales en la India y Kenya (114). Recientemente, la pentamidina ha demostrado ser altamente eficaz contra la LC en Colombia (115). Su toxicidad ha sido una limitación en su uso, pues se ha reportado hipoglucemia, diabetes, nefrotoxicidad, taquicardia y dolor en el sitio de inyección (115, 116). La actividad anti-leishmanial de los alquil-lisofosfolipidos como la miltefosina se registró por primera vez en 1987, específicamente contra promastigotes y amastigotes de L. (L.) donovani (117). Estudios diferentes confirmaron la alta actividad in vivo de la miltefosina contra L. (L.) donovani, con >98% de supresión de amastigotes en el hígado y el bazo de los ratones después de la administración de 10 mg/kg x 5 dosis (118). Contra L. (L.) infantum, el tratamiento oral durante 5 días con 20 mg/kg de peso corporal/día, dio lugar a la supresión de amastigotes en el bazo y el hígado en un 78 y 94 %, respectivamente (119). Por tanto, la miltefosina ha sido usada como un nuevo fármaco oral para el tratamiento de la leishmaniasis visceral (120). En las fases 1, 2 y 3 de ensayos clínicos para el tratamiento de leishmaniasis visceral leve a moderada en Bihar (India) ha tenido una tasa de curación de 95% cuando se utiliza a una dosis de 100 mg/kg durante 28 días (121, 122). En un ensayo en Colombia, un esquema de tratamiento de 28 días con dosis orales de 100 mg/kg o 150 mg/kg dio una tasa de curación de 90% de LC causada por L. (V.) braziliensis o L. (V.) panamensis (9). La tasa de curación de la LMC en Bolivia, ya sea por tratamiento de 4 o 6 semanas fue de aproximadamente 70% (123). El fármaco también ha demostrado ser eficaz contra los casos de resistencia a antimoniales (124). La miltefosina es un compuesto teratogénico que genera efectos tóxicos reversibles. Si bien todos los ensayos han sido reportados en pacientes VIH negativos, la eficacia de la miltefosina en ratones inmunodeficientes sugiere que esta podría ser usada para el tratamiento de co-infecciones VIH/LV (125). Actualmente, el uso oral de la miltefosina está aprobado para el tratamiento de LV en India y Etiopia, LC en Bolivia y Colombia y 34

35 MARCO TEÓRICO para formas menos frecuentes de la enfermedad que requieren largos periodos de tratamiento (126). Por otra parte, terapias combinadas de aminoglucósidos como la paromomicina y antimoniales pentavalentes están siendo usadas para tratar LCD causada por L. (L) aethiopica (127) y LV (128, 129). Finalmente, los inhibidores de la vía de biosíntesis de esterol, en particular los azoles como el ketoconazol, fluconazol, miconazol y clotrimazol, en conjunto con el fexinidazol, un compuesto de la familia de los nitroimidazoles, están siendo evaluados como nuevas alternativas al tratamiento contra la leishmaniasis ( ). 35

36 MARCO TEÓRICO 4.2 Generalidades del parásito Leishmania Taxonomía Las Leishmanias son protozoarios pertenecientes al orden Kinetoplastida, orden caracterizado por la presencia del kinetoplasto (red concatenada de ADN circular que contiene numerosas copias del genoma mitocondrial). Leishmania, junto con Trypanosoma, Phytomonas y Endotrypanum constituyen los cuatro géneros de parásitos digenéticos pertenecientes a la familia Trypanosomatidae, agrupación caracterizada por la presencia de un único flagelo. El género Leishmania comprende dos subgéneros: Leishmania Viannia y Leishmania Leishmania, los cuales se diferencian sobre la base de su desarrollo en el intestino del vector. Así, el subgénero Leishmania Leishmania se desarrolla en la parte anterior del píloro (suprapilaria) y los parásitos del subgénero Leishmania Viannia se desarrollan alrededor del píloro (peripilaria) (1, 133). Los complejos en Leishmania, aunque no corresponden a una categoría taxonómica, son muy utilizados para agrupar especies relacionadas cuyo estatus es cuestionable (figura 1) (134). Reino Protista Subreino Protozoa Phyllum Sarcomastigophora Subphyllum Mastigophora Clase Zoomastigophorea Orden Kinetoplastida Suborden Trypanosomatina Familia Trypanosomatidae Género Leishmania Subgénero Leishmania Viannia Especie Leishmania Viannia braziliensis 36

37 MARCO TEÓRICO Subreino Orden Familia Género Subgénero Complejo Especies No patógenas para el hombre Viejo mundo No hay clasificación definitiva Nuevo mundo Figura 1. Taxonomía de Leishmania, las especies subrayadas son o han sido cuestionadas, tomado de Banuls y colaboradores, 2007 (1). 37

38 MARCO TEÓRICO La clasificación taxonómica tradicional de L. (V.) braziliensis, basada principalmente en criterios morfológicos, se describe en la página 35 y se muestra en la Figura 1. Recientemente, la Sociedad de Protozoología, propuso un nuevo esquema de clasificación de los organismos Eucariotas, basados en análisis de vías bioquímicas y estudios de filogenia molecular (135). Así, el género Leishmania en conjunto con los otros miembros de la familia Trypanosomatidae, se ubica en el Super-grupo Chromalveolata, primer rango Alveolata y segundo rango Euglenozoa (135) Ciclo de vida Figura 2. Ciclo de vida de Leishmania, tomado de org/informacionidi/noticias/noticia.asp?id=

39 MARCO TEÓRICO Durante su ciclo de vida, los parásitos del genero Leishmania presentan 2 estadios morfológicos principales: el promastigote, formas alargadas con un flagelo externo que se encuentran en el tubo digestivo del insecto flebótomo y el amastigote, formas redondas sin flagelo externo, que se diferencian al interior de las células del hospedero vertebrado (1, 76) (ver Figura 2). El ciclo inicia cuando un flebótomo hembra se alimenta de sangre de un mamífero doméstico o silvestre infectado. Los amastigotes presentes en las células fagocíticas de la sangre del mamífero, en el tubo digestivo del insecto se transforman en promastigotes procíclicos los cuales se dividen activamente (ver figura 2). Posteriormente, los promastigotes se diferencian en la forma infectiva de promastigotes metaciclicos y migran a la parte anterior del tubo digestivo del insecto. En una alimentación posterior, el flebótomo hembra inocula promastigotes metaciclicos en la piel de un hospedero vertebrado y los parásitos son endocitados por células fagocíticas. Al interior de estas células, los promastigotes se transforman en amastigotes y se dividen múltiples veces, hasta que la célula hospedera estalla y los amastigotes libres invaden nuevas células (ver Figura 2) (1, 76). El ciclo se cierra cuando otro flebótomo hembra se alimenta de la sangre infectada. 39

40 MARCO TEÓRICO 4.3 Genética y biología molecular de Leishmania Genoma nuclear Hasta el momento se tiene el genoma de 5 especies de Leishmania y sus secuencias están disponibles en la base de datos libre del GeneDB (136). El primer proyecto genoma de Leishmania se inició en 1994 con la cepa Friedlin de L. (L.) major y fue publicado en su totalidad en el 2005 (137). El tamaño del genoma de L. (L.) major se ha estimado en 32,8 Mb por genoma haploide, distribuidas en 36 pares de cromosomas (138). Los cromosomas son lineales, entre 200 y 4000 kb de longitud, poseen telómeros, pero no se han identificado centrómeros (139). La variabilidad en tamaño cromosómico es característica de algunas especies de Leishmania, incluso entre cromosomas homólogos ( ). El genoma de L. (L.) major codifica para 911 genes de ARN, 97 pseudogenes y 8298 genes que codifican proteínas (143), al 36% de las cuales se les ha podido atribuir una función putativa. La mayor parte de los genes no poseen intrones, se encuentran en múltiples copias y frecuentemente están organizados en tándem o menos comúnmente, dispersos en el genoma (137, 144). Mientras que las especies de Leishmania del Viejo Mundo tienen 36 pares de cromosomas (0,28-2,8 Mb) (138), las especies del Nuevo Mundo tienen 34 o 35, con los cromosomas 8 y 29, y 20 y 36, fusionados en L. (L.) mexicana y 20 y 34 en L. (V.) braziliensis (145). El genoma de L. (V.) braziliensis contiene 33 Mb que codifican para genes (incluyendo los pseudogenes). Más de 10% del genoma corresponde a secuencias de ADN repetido. Cerca de 99% de los genes se mantienen en sintenia con los genomas de L. (L.) major y L. (L.) infantum. La identidad del genoma de L. (V.) braziliensis con el genoma de las dos especies de Leishmania 40

41 MARCO TEÓRICO mencionadas anteriormente es de 77% (143). En la Tabla 4 se muestra un resumen de las características del genoma de L. (L.) major, L. (L.) infantum y L. (V.) braziliensis. Recientemente, se ha reportado que L. (V.) braziliensis es triploide en 30 de sus 35 cromosomas, los cromosomas 4, 5 y 29 son tetrasómicos y el 31 es hexasómico (146). Con base en lo anterior, L. (V.) braziliensis es claramente la más divergente de las especies hasta ahora secuenciadas (143) y la mayor fuente de variación se observa en el número de copias de genes y pseudogenes (146). Tabla 4. Resumen de las características del genoma de L. (L.) major, L. (L.) infantum y L. (V.) braziliensis L. (L.) major L. (L.) infantum L. (V.) braziliensis (V2) (V5.2) (V2) Numero de Cromosomas Contigs Tamaño en pb % de G+C total 59,70 59,30 57,76 Genes que codifican proteínas Genes multicopia Pseudogenes % de G+C en regiones 62,50 62,45 60,38 codificantes Modificado de Peacock y colaboradores, 2007 (143); Rogers y colaboradores (146). En el genoma de L. (V.) braziliensis se han encontrado varios elementos transponibles como: 1) Los elementos DIRE relacionados con el retrotansposon ingi/l1tc (147); 2) Repeticiones en tándem asociadas a las secuencias del grupo de genes SL en una disposición similar a la de los retrotransposones SLACS (por su sigla en inglés Spliced Leader Associated Conserved Sequence) presentes en T. brucei (148) y CZAR (por su sigla en inglés cruzi-associated retrotransposon), 41

42 MARCO TEÓRICO presentes en T. cruzi (149); 3) Una familia de elementos transponibles de ADN localizados en los telómeros denominados elementos transponibles asociados a telómeros (TATE) (143, 150) y 4) Elementos transponibles extintos como los denominados SIDERs (por su sigla en inglés: Short Interspersed Degenerated Retroposons), los cuales se encuentran de forma abundante en el genoma del parásito (1986 elementos por genoma) (151, 152). La vía de ARN de interferencia (ARNi), es desencadenada por ARN de doble cadena (ARNdc) y se activa como mecanismo de defensa específica para eliminar ácidos nucleicos invasores potencialmente peligrosos, tales como virus o transcritos derivados de retroposones y transposones (153). En L. (V.) braziliensis y otras especies dentro del subgénero Leishmania Viannia, se han detectado los genes que componen la maquinaria de ARNi, observándose fuerte atenuación de la expresión de una variedad de genes reporteros y endógenos (143, 154, 155). A pesar de las amplias diferencias en las manifestaciones clínicas de la enfermedad causada por las diferentes especies del parásito, solo 47 genes que se distribuyen por todo el genoma son específicos de L. (V.) braziliensis (ver Tabla 5). Además, L. (V.) braziliensis carece de un número casi equivalente de genes presentes en L. (L.) major y L. (L.) infantum (143). Así, la formación de pseudogenes y la pérdida de genes son las principales fuerzas que distinguen a los diferentes genomas de Leishmania. Se cree además que los genes que se expresan específicamente a partir del genoma en las diferentes especies de Leishmania, codifican proteínas implicadas en las interacciones hospederopatógeno (143) y que estas diferencias pueden contribuir en parte al desarrollo de las diferentes formas de leishmaniasis (150). 42

43 MARCO TEÓRICO Tabla 5. Genes de L. (V.) braziliensis que no se encuentran (-) o son pseudogenes (en rojo) en L. (L.) major y L. (L.) infantum. Genes de L. (L.) L. (L.) major L. (V.) braziliensis L. (V.) braziliensis infantum SLACS - - LbrM02_V SLACS - - LbrM02_V SLACS - - LbrM02_V Proteína hipotética repetida - - LbrM03_V Metiltransferasa LmjF LinJ LbrM04_V Proteína hipotética - - LbrM05_V Proteína hipotética LmjF LinJ LbrM06_V Proteína hipotética LmjF LbrM07_V Proteína hipotética LmjF LinJ LbrM10_V Proteína hipotética LmjF LinJ LbrM19_V Argonauta LmjF LinJ LbrM11_V Proteína hipotética - - LbrM11_V Proteína hipotética LmjF LinJ LbrM11_V Proteína hipotética - - LbrM13_V Proteína hipotética LmjF LinJ LbrM14_V Proteína hipotética repetida - - LbrM14_V Proteína hipotética LmjF LmjF LbrM22_V Proteína hipotética LmjF LbrM22_V Proteína hipotética - - LbrM22_V Proteína hipotética - - LbrM22_V Gen con dominio ARNasa III - - LbrM23_V Proteína hipotética - - LbrM23_V Proteína hipotética LmjF LinJ LbrM23_V Proteína hipotética - - LbrM24_V

44 MARCO TEÓRICO Proteína hipotética LmjF LbrM25_V Gen ARNasa III - - LbrM25_V Proteína hipotética - - LbrM26_V Adenin fosforribosil transferasa - - LbrM26_V Proteína hipotética LmjF LinJ LbrM26_V Glutation peroxidasa - - LbrM26_V Proteína hipotética LmjF LinJ LbrM27_V Proteína hipotética - - LbrM27_V Proteína hipotética LmjF LinJ LbrM28_V Proteína hipotética - - LbrM28_V Tirosina/dopa descarboxilasa LmjF LinJ LbrM30_V Proteína hipotética - - LbrM30_V Proteína hipotética - - LbrM31_V Proteína hipotética - - LbrM32_V Proteína hipotética - - LbrM32_V Proteína hipotética LmjF LinJ LbrM33_V Proteína hipotética - - LbrM33_V Proteína hipotética LmjF LinJ LbrM33_V Beta galactofuranosil transferasa - - LbrM20_V Proteína hipotética - - LbrM34_V Galactokinasa - - LbrM34_V Transportador de aminoacidos - - LbrM35_V Proteína hipotética LmjF LinJ LbrM35_V Proteína hipotética - - LbrM35_V Proteína hipotética LmjF LinJ LbrM35_V Modificado de Peacock y colaboradores, 2007 (143). 44

45 MARCO TEÓRICO Regulación de la expresión génica Para adaptarse a diferentes ambientes Leishmania requiere la capacidad de modular su expresión génica y varios cientos de ARNm muestran al menos una doble regulación a lo largo de los estadios de desarrollo del parásito (156). Sin embargo, no se han encontrado promotores específicos para la ARNpol II (11, 13, 157, 158), como tampoco se ha detectado la presencia de factores de transcripción (137) y se considera que el genoma de Leishmania se expresa constitutivamente (159). De manera interesante, se ha observado mediante análisis proteómico cuantitativo de la expresión relativa de proteínas en Leishmania, que existe una baja correlación entre los niveles de expresión de proteína y de los ARNm. Por lo tanto, la expresión de proteínas de Leishmania es regulada a nivel post-transcripcional y/o traduccional (11, 159). El único promotor de la ARNpol II que se ha caracterizado en Leishmania se encontró asociado a la expresión del ARN de la secuencia líder (SL) de L. tarentolae (160). Los demás genes transcritos por la ARNpol II se transcriben como policistrones (161), en unidades conocidas como PGC (por su sigla en inglés Polycistronic Gene Cluster ) (12), en donde cada cromosoma contiene al menos dos PGC, que pueden ser divergentes (la dirección de la transcripción es hacia los telómeros) o convergentes (la dirección de la transcripción es desde los telómeros hacia el centro del cromosoma). Los genes de un PGC en tripanosomátidos generalmente no codifican proteínas funcionalmente relacionadas (162). Antes de su traducción a proteína, los policistrones deben ser procesados a ARN monocistrónicos maduros mediante la acción de dos reacciones acopladas conocidas como trans-splicing y poliadenilación, que cortan las regiones intergénicas del ARNm. En la reacción de trans-splicing, la secuencia SL, de 39 nucleótidos portadora de la estructura conocida como cap-4 (163, 164), es adicionada para generar el extremo 5 del ARNm. El empalme de la secuencia SL 45

46 MARCO TEÓRICO ocurre en la región 5 no codificante del gen, específicamente en un dinucleótido AG, señalizado por la presencia, corriente arriba, de un tracto de polipirimidinas (165). Por su parte, el extremo 3 del ARNm es generado por clivaje endonucleolitico y posterior adición de una cola de poliadeninas, evento que en tripanosomátidos generalmente ocurre corriente abajo de una región rica en residuos de adeninas ( ) (ver Figura 3). Figura 3. Procesamiento de pre-arnm en Leishmania. La regulación de la expresión génica en Leishmania tiene características únicas comunes entre los tripanosomátidos que incluyen transcripción policistrónica de grandes unidades de ARNm por una ARNpol II, la ausencia de elementos promotores y el procesamiento del pre-arnm en ARNm monocistrónicos a través del transsplicing y la poliadenilación, eventos que están mecánicamente acoplados en estos parásitos. Modificado de Papadopoulou y colaboradores, 2003 (169). Debido a la falta de promotores para la ARNpol II y que los genes que codifican proteínas se transcriben constitutivamente como PGC, el control de la expresión génica en Leishmania depende de procesos post-transcripcionales 46

47 MARCO TEÓRICO relacionados con el procesamiento, la estabilidad y la traducción del ARNm (11-13, 159). Estos eventos requieren la interacción entre secuencias en el ARNm (cis-elementos) y factores proteicos (trans-elementos) (11). Se ha demostrado que los cis-elementos reguladores se encuentran principalmente en las regiones 3 y 5 no traducidas (3 UTR y 5 UTR) del ARNm ( ) Regulación a nivel del procesamiento y maduración de los ARNm La eficiencia del trans-splicing y la poliadenilación juega un papel importante en la generación de monocistrones maduros y por ende en el control de los niveles de ARNm. Así, se conoce que los pre-arnm son inestables (177). Un ejemplo es ilustrado por los genes CPB (cisteín proteasa B) que están dispuestos en tándem en L. (L.) mexicana y son diferencialmente expresados: CPB1 y CPB2 se expresan predominantemente en promastigotes metacíclicos, mientras que CPB3- CPB18 se expresan principalmente en amastigotes. Se ha encontrado que una región intercistronica de 120 pb media la regulación de CPB en las formas metacíclicas al afectar la maduración de los pre-arnm policistrónicos (178). Se propone que las proteínas implicadas en dicha regulación se unen directamente a los ARNm nacientes reduciendo la eficiencia de la maduración o afectando la estabilidad del pre-arnm (179) Regulación a nivel de la estabilidad de los ARNm Los procesos de degradación del ARNm cumplen un papel fundamental en tripanosomátidos ( ) debido a que la expresión génica en estos organismos es regulada de manera post-transcripcional. La estabilidad de los transcritos depende en gran medida de la interacción entre cis y trans-elementos que aumentan o disminuyen la vida media de estos, dependiendo de los 47

48 MARCO TEÓRICO requerimientos celulares (11). Algunos ejemplos de este tipo de regulación en Leishmania son: Se ha descrito que los genes A2 son regulados a través del desarrollo de L. (L.) donovani siendo expresados preferiblemente en amastigotes. Sin embargo, su expresión puede ser inducida experimentalmente en promastigotes por una combinación de ph y cambios de temperatura, que simulan el paso desde el ambiente del insecto vector al del fagolisosoma. La expresión durante la diferenciación de promastigote a amastigote es regulada a través de la estabilidad del ARNm dependiente de secuencias presentes en las 3 UTR. Así, se demostró que la estabilidad de los transcritos de genes reporteros que llevan la 3 UTR del gen A2 aumenta cuando los parásitos son cultivados a ph bajo (170). La abundancia del ARNm de los genes A600-4 implicados en la replicación de los amastigotes de L. (L.) mexicana (183) es ocho veces mayor en amastigotes que en promastigotes (184). Mediante construcciones quiméricas usando el gen luciferasa unido a la región 3 UTR del gen A600-4, se evidenció la presencia de cis-elementos sobre la 3 UTR, que estabilizan los transcritos A600-4 en el estadio amastigote y además regulan la eficiencia de la traducción (184). La acumulación del ARNm de la proteína de choque térmico HSP83 en L. (L.) amazonensis se produce debido a una mayor estabilidad de los ARNm bajo condiciones de choque térmico. Un patrón similar de regulación posttranscripcional se observó al transfectar el gen reportero cloranfenicol acetiltransferasa (CAT), flanqueado en ambos extremos por regiones intergénicas (IR) del gen HSP83. Se descubrió que las regiones UTR median este mecanismo, ya que el acortamiento de la región 5 UTR si bien generó una enzima activa, suprimió la regulación dependiente de la temperatura. A su vez, el intercambio de la 3 UTR del gen HSP83 por un fragmento equivalente de un gen no relacionado con el choque térmico abolió la expresión diferencial del ARNm dependiente del choque térmico (185, 186). 48

49 MARCO TEÓRICO Se ha identificado una región de 202 nucleótidos dentro de la 3 UTR del gen que codifica la principal proteasa de superficie (MSPL) de L. chagasi que aumenta la vida media y por tanto la abundancia del ARNm cuando se inhibe la traducción con cicloheximida. Por tanto, los autores sugieren que esta región puede interactuar con un factor proteico regulador lábil (187). El gen PFR2 (por su sigla en inglés paraflagellar rod) de L. (L.) mexicana se expresa sólo en el estadio del parásito que se desarrolla en el insecto, así los niveles de ARNm del gen PFR2 son 10-veces más bajos en amastigotes que en promastigotes. En la región 3 UTR del respectivo mensajero se identificó un elemento regulador de 10 nucleótidos denominado PRE, que actúa desestabilizando el ARNm de PFR2 en amastigotes. Adicionalmente, el elemento PRE, presente en las 3 UTR de otros genes que se expresan solo en promastigotes en L. (L.) mexicana, también coordina la expresión de estos genes en dicho estadio (171, 176) Regulación a nivel de la eficiencia de la traducción El complejo de iniciación de la traducción escanea la región 5 UTR hasta que alcanza el codón de inicio (AUG). Estructuras secundarias sobre la 5 UTR, pueden ocultar o afectar el reconocimiento correcto del codón de iniciación. Cambios en dichas estructuras en respuesta a la temperatura o a moléculas pequeñas de ARN también pueden influir en la iniciación y la elongación de la traducción (188). También, es posible encontrar elementos en las regiones 3 UTR que interactúan con proteínas represoras, previniendo la circularización del ARNm durante la iniciación de la traducción (189). La mayoría de los esfuerzos por mapear secuencias reguladoras en Leishmania y Trypanosoma han demostrado que la regulación de la traducción se origina en la región 3 UTR (173, 190, 191) y que la región 5 UTR actúa en 49

50 MARCO TEÓRICO sinergia con esta (175, 190, 192). Algunos ejemplos de este tipo de regulación se presentan a continuación. La amastina es una proteína de superficie de Leishmania y forma parte de una familia de genes regulados a través del desarrollo del parásito. Se ha demostrado que la acumulación de esta proteína en amastigotes es causada por la presencia de una secuencia de 450 nucleótidos (nt) en la región 3 UTR del ARNm (193). Esta región de 450 nt confiere expresión específica en amastigotes a través de un mecanismo que aumenta la eficiencia de la traducción, sin aumentar la estabilidad del ARNm (194). Este elemento de 450 nt está presente y es altamente conservado en varios ARNm de Leishmania y además se ha demostrado que estimula la iniciación de la traducción del ARNm para la amastina en L. (L.) infantum en respuesta al choque térmico (195). La expresión de los genes HSP83 en L. (L.) infantum es afectada por la temperatura y por el estadio de diferenciación del parásito y está regulada a nivel de la traducción y la estabilidad del ARNm (172). En la región 3 UTR de estos genes en L. (L.) amazonensis, existe una región de 150 nt rica en pirimidinas que es necesaria, pero no suficiente para la traducción preferencial. Se sugiere que a temperaturas elevadas este elemento regulador de 150 nt es más accesible a los factores proteicos que promueven su interacción con los componentes basales de la traducción en el extremo 5 durante la circularización del ARNm (196) Genoma mitocondrial y edición del ARN El ADNk es el ADN mitocondrial de los kinetoplastidos y constituye 10-20% del ADN total (18). El kinetoplasto es una red compleja formada por dos clases de moléculas de ADN circular concatenadas entre sí: los maxicírculos y los minicírculos (figura 4). Los primeros con tamaños de 20 a 38 kb y 20 a 50 copias por kinetoplasto, son moléculas conservadas con excepción de la región divergente (DR), la cual se caracteriza por poseer elementos repetidos y tener una 50

51 MARCO TEÓRICO región variable, que es de 4073 nt en L. tarentolae ( ). Los minicírculos tienen un tamaño que varía entre 0,7 a 1.0 kb dependiendo de la especie de Leishmania, se encuentran repetidos entre a veces por kinetoplasto, codifican para los ARN pequeños ricos en uridinas conocidos como ARN guías (ARNg) y se caracterizan por presentar una amplia variabilidad en sus secuencias (18, 197, 200). Figura 4. ADNk de Leishmania. El ADNk es una red que contiene miles de moléculas de ADN concatenadas (minicírculos y maxicírculos). Micrografía electrónica tomada de Banuls, 2007 (1). En Leishmania, los maxicírculos codifican para dos ARN ribosomales (ARNr), algunos ARNg y 18 genes estructurales incluyendo la proteína ribosomal S12 (RPS12), varias de las enzimas de la cadena respiratoria mitocondrial como la apocitocromo b (CyB), las subunidades I, II y III de la citocromo C oxidasa COI, COII, COIII y las subunidades de la NADH deshidrogenasa ND1, ND3, ND4, ND7, 51

52 MARCO TEÓRICO ND8 y ND9 y cuatro marcos de lectura abiertos conocidos como MURF1, MURF2, MURF5 (16, 18, 19, 201) y MURF4 o ATPasa 6 (202). La información codificada por algunos de estos genes se encuentra encriptada, así, los transcritos generados con frecuencia carecen de codones que indiquen el inicio o fin de la traducción y la secuencia codificante está incompleta (203). Por tanto, antes de ser traducidos, estos transcritos deben experimentar un proceso de edición, en el cual, mediante la inserción o deleción de residuos de uridinas en sitios específicos del ARN naciente o pre-editado se generan los marcos de lectura correctos (204, 205). Este mecanismo de edición, tiene una progresión en sentido 3 5 y es asistido por los ARNg, los cuales actúan de molde o plantilla ( ). El ARNg en su zona de anclaje, ubicada en su extremo 5, forma un dúplex de 10 a 15 nt con el ARNm pre-editado. El número de uridinas adicionadas es guiado por la cantidad de adenosinas o guanosinas sin aparear con el ARN pre-editado presentes en el ARNg corriente abajo del dominio de anclaje. En tanto que, los residuos de uridinas a delecionarse se marcan por su ausencia en el extremo 3 del fragmento que sobresale del dúplex ARNg:ARNm (209). Se conoce el genoma del maxicírculo de algunas especies de kinetoplastidos como L. tarentolae (18, 19), L. (L.) donovani (16), T. brucei (18, ) y T. cruzi (213) y secuencias parciales de los maxicírculos de L. (L.) major (17), L. (L.) amazonensis (15), C. fasciculata (214, 215) y P. serpens (216, 217). No obstante, se desconoce la organización del genoma del maxicírculo y la existencia de edición del ARN en especies de Leishmania del subgénero Leishmania Viannia. 52

53 MARCO TEÓRICO 4.4 Proteína de choque térmico de 70 kda (HSP70) En parásitos que alternan entre hospederos invertebrados y vertebrados, las fluctuaciones drásticas de temperatura son una parte rutinaria del ciclo de vida. La presencia de proteínas de estrés se ha demostrado en varios de dichos organismos, incluidos los miembros de los géneros Trypanosoma y Leishmania. Como tal, la adaptación de estos organismos para la supervivencia durante un amplio intervalo de temperatura, sugiere que la respuesta al choque térmico juega un papel importante en la supervivencia del parásito y su diferenciación (218, 219). Entre las HSP, la HSP70 es la más conservada en secuencia y función (219). Las proteínas HSP70 son componentes centrales de la red celular de chaperonas moleculares, catalizadores del plegamiento de proteínas, replegamiento de proteínas mal plegadas y agregadas, estas proteínas también previenen la agregación de proteínas que serán insertadas en membranas, contribuyen con el transporte de proteínas hacia organelos como la mitocondria y participan en el control de la actividad de proteínas reguladoras como la ADNasa activada por caspasas (CAD) ( ). La HSP70 ejerce su función en el plegamiento de proteínas mediante la asociación transitoria de su dominio de unión al sustrato con segmentos cortos de péptidos hidrófobos de las proteínas sustrato. El ciclo de unión y de liberación del sustrato es accionado por la conmutación de la proteína HSP70 entre el estado de baja afinidad (unida a ATP) y el estado de alta afinidad (unida a ADP). Por lo tanto, la unión de ATP y la hidrólisis son esenciales in vitro e in vivo para la actividad chaperona de las proteínas HSP70. Este ciclo ATPasa es controlado por cochaperonas de la familia de proteínas de dominio J, que dirigen la HSP70 a sus sustratos y por factores de intercambio de nucleótidos, que determinan el tiempo de vida del complejo HSP70-sustrato (229). 53

54 MARCO TEÓRICO Debido a que la HSP70 es abundantemente secretada al medio extracelular, también induce una fuerte respuesta inmune humoral y celular, por lo cual se considera también como un inmunomodulador del sistema inmune del hospedero (230). Interesantemente, en relación a los genes HSP70 de Leishmania, se han descrito en L. (L.) infantum, L. (L.) major, L. tropica, L. (L.) mexicana y L. (L.) amazonensis (14, 231) dos tipos de genes denominados HSP70-I y HSP70-II, que comparten la región 5 UTR y la región codificante, pero que difieren en su 3 UTR. En general, estos genes están dispuestos en una única agrupación genómica que contiene cinco o seis copias de los genes HSP70-I, seguidos de una copia del gen HSP70-II. En L. (L.) infantum, se ha demostrado que, mientras que el ARNm del gen HSP70-I se acumula en respuesta al choque térmico y se traduce tanto a 26 como a 37 C, el ARNm del gen HSP70-II no muestra una acumulación dependiente de la temperatura, pero se traduce preferencialmente a temperaturas de choque térmico (231). La estricta conservación del arreglo de genes HSP70 en todas las especies de Leishmania analizadas hasta ahora (14) sugiere que este tipo de disposición debe tener un papel funcional importante. La proteína HSP70 de Leishmania participa en otros procesos celulares de interés. Es así como, se ha observado sobreexpresión de la proteína HSP70 en aislados de varias especies de Leishmania resistentes a antimonio, lo que indica que este aumento del nivel de expresión de la proteína confiere protección contra los antimoniales ( ). Estudios recientes también han demostrado que el bloqueo de la expresión del gen HSP70 a nivel de ARNm con oligonucleótidos antisentido induce muerte celular programada y causa defectos en el ciclo celular (236). Por otra parte, la interrupción del gen HSP70-II de L. (L.) infantum causa un efecto perjudicial sobre el crecimiento y la morfología de los promastigotes en la fase estacionaria de mantenimiento, sobre la progresión del ciclo celular en la transición de la fase G 2 /M en ambos estadios del parásito, por lo tanto, la virulencia de este en ratones también se ve afectada (21). Además, ratones 54

55 MARCO TEÓRICO BALB/C, ratones inmunodeficientes y hamsters, no desarrollan ningún signo de patología, tras ser inoculados con parásitos mutantes carentes del gen HSP70-II (22). En general, los anteriores datos ponen de relieve el papel fundamental que desempeñan las proteínas HSP70 de Leishmania en la virulencia y supervivencia del parásito, señalando a este gen o los factores que regulan su expresión como blancos prometedores para intervenciones terapéuticas. 55

56 MARCO TEÓRICO 4.5 -tubulinas Las tubulinas son proteínas fundamentales en la conformación del cito-esqueleto, de la maquinaria de división celular y de los orgánulos responsables de la motilidad del parásito. También intervienen en el transporte intracelular y el control de la traducción (237, 238). Existe una gran familia de proteínas tubulinas, sin embargo, el heterodímero alfa/beta ( / ), es el principal constituyente de los microtúbulos de los kinetoplástidos (239). En microorganismos unicelulares como Leishmania, la forma y motilidad de las células son particularmente relevantes ya que muchos aspectos de su biología como la infectividad y la transmisión dependen de éstas (238). Por lo anterior, el estudio de la expresión de las proteínas que conforman el citoesqueleto y participan en la motilidad del parásito como las -tubulinas, es de gran interés. Adicionalmente, dado que las -tubulinas son el blanco de acción de varios medicamentos usados para tratar el cáncer, las infecciones por hongos y por helmintos (240, 241), estas proteínas también han sido consideradas para el desarrollo de fármacos anti-leishmaniales. En tripanosomas, los genes y -tubulina se organizan de forma alterna en un solo tándem. Por el contrario en Leishmania, estos genes forman agrupaciones separadas, ubicadas en distintos cromosomas (242). La organización genómica de los genes tubulina se ha analizado en distintas especies de Leishmania, mostrando la existencia de múltiples copias, dispuestas en tándem y algunas dispersas en el genoma (242, 243). Por ejemplo, los genes -tubulina en L. enriettii se organizan en un tándem de 15 copias con una unidad de repetición de 2,2 kb (243). El análisis de los cromosomas de L. enriettii mediante electroforesis de campo pulsado (PFE) demostró diferencias en el tamaño de los cromosomas que contienen estos genes (244). Así, mediante análisis de restricción de las regiones flanqueantes y el análisis del tamaño de los tándem en los geles de PFE con los cromosomas digeridos, se determinó que el tándem de mayor tamaño, se 56

57 MARCO TEÓRICO sitúa en el cromosoma más grande, con alrededor de 18 a 20 copias del gen - tubulina, mientras que el otro tándem, tiene de 10 a 11 copias (245). En L. (L.) major, se estimó la presencia de una agrupación de copias en el cromosoma 13 del parásito (136, 246). En L. (L.) donovani, también se determinó la presencia de un tándem con múltiples copias de los genes -tubulina (247). Por su parte, el genoma de L. (L.) infantum presenta dos locus para los genes - tubulina, uno, hacia el extremo 5 del cromosoma con una sola copia y el otro, hacia al extremo 3 con una copia completa y una copia parcial. Sin embargo, los locus de los genes -tubulina en el genoma reportado de L. (V.) braziliensis presentan vacíos en las secuencias y el ensamblaje, que no han permitido confirmar la organización genómica de éstos (146). En cuanto a la expresión de estos genes en Leishmania, estudios clásicos han demostrado que los promastigotes sintetizan más tubulinas ( y tubulinas) que los amastigotes y que este cambio biosintético de las tubulinas se correlaciona con el cambio morfológico sufrido por el flagelo y el citoesqueleto durante la transformación de promastigote a amastigotes ( ). Estudios dirigidos a descubrir la regulación responsable de la expresión diferencial de los genes codificantes para las tubulinas en Leishmania, revelaron que mientras en L. enriettii la regulación depende de la estabilidad de los ARNm (251), en L. (L.) mexicana obedece a mecanismos de actividad traduccional (252, 253). En relación a T. cruzi, diversos estudios sugieren la existencia de un mecanismo autorregulatorio responsable de la acumulación diferencial del ARNm de las tubulinas (249, 250). No obstante, el mecanismo responsable de la regulación de la expresión de los genes -tubulina en L. (V.) braziliensis aún no se comprende con exactitud. 57

58 MARCO TEÓRICO 4.6 Subunidad 8 de la nicotinamida adenín dinucleótido ubiquinona oxidoreductasa (ND8) El gen ND8 codifica para la subunidad proteica 8 del complejo enzimático NADH deshidrogenasa o NADH ubiquinona oxidoreductasa (EC ), también conocido como complejo I ( ). Este complejo, localizado en la membrana interna de la mitocondria de las células eucariotas, cataliza la transferencia de electrones del NADH a la coenzima Q (CoQ) o ubiquinona, en el primer paso de la cadena respiratoria. Simultáneamente al transporte de electrones, el complejo bombea protones a través de la membrana de la mitocondria, contribuyendo a la generación de un gradiente electroquímico, usado para la síntesis de ATP o transporte de solutos (257). En los mamíferos, el complejo I puede estar formado por 45 proteínas, de las cuales 7 se codifican en el genoma mitocondrial. En tripanosomátidos, la presencia del complejo I ha sido ampliamente debatida (206, ). Estudios bioinformáticos recientes, predicen para el caso de T. brucei, la existencia de un complejo I compuesto por 19 subunidades de masa molecular de 661 kda (261). Dicho complejo, mientras contiene todas las unidades involucradas en el transporte de electrones; tan solo contiene 4 subunidades de las implicadas en el bombeo de protones, motivo por el cual se considera que este complejo está implicado en la generación de NAD + mitocondrial, pero no en la transducción de energía en este parásito (261). Resultados, que concuerdan con hallazgos previos que evidencian en las formas procíclicas del parásito (insecto vector) la presencia del complejo I con masa molecular de 600 kda y actividad NADH oxidasa sensible a rotenona, inhibidor clásico del complejo I (262). Es más, la concentración de rotenona requerida por T. brucei para inhibir el 50% de la actividad enzimática fue mucho mayor que la requerida por otros eucariotes (261, 262). Por su parte, en las formas sanguíneas del parásito, también se ha evidenciado la presencia de transcritos funcionales (completamente editados) para 58

59 MARCO TEÓRICO algunas subunidades del complejo I, pero hasta el momento no se tiene evidencia de un complejo I funcional (261). Por su parte, en Phytomonas serpens, también se ha logrado aislar el complejo I, el cual tiene una masa de 700 kda y está conformado por 11 subunidades. La actividad de este complejo en las formas que se desarrollan en el insecto también mostro inhibición por rotenona (263). En otros tripanosomátidos como Leishmania, es poco lo que se sabe acerca de la existencia y función del complejo I tanto en la forma promastigote como amastigote del parásito. A inicio de la década de los 90, Souza y colaboradores (1992) encontraron que los transcritos de la región en ese entonces denominada CR1 (de G versus C strand bias) de los maxicírculos de T. brucei eran extensivamente editados a lo largo de toda la molécula ( pan-editing ), originando una proteína de 145 aa del tipo de las ferredoxinas, con un peso molecular teórico de 17 kda, caracterizada por la presencia de centros de hierro y azufre. Dicha proteína, nombrada más tarde como ND8, presenta similaridad con la subunidad NDUFS8 humana, una de las 14 subunidades constituyentes del core enzimático del complejo I, codificada por el genoma nuclear humano. Llamativamente, los transcritos de CR1 o ND8, tanto editados como no editados, son más abundantes en las formas sanguíneas del parásito que en las procíclicas. Así, dado que la energía en las formas sanguíneas proviene en su mayoría de la glicolisis, en la mitocondria se debe regenerar NAD +, a partir del NADH producido durante la glicolisis. Por tanto, los autores sugieren que la subunidad ND8 participa en el mantenimiento del balance NAD + /NADH mitocondrial (264). En Leishmania, el gen ND8 se encuentra corriente arriba del gen ND7 y corriente abajo del gen para el ARNr 9S. Llamativamente, en la región intergénica entre ND7 y ND8 en la hebra complementaria se codifican los genes MURF5 y ND9 (15, 17, 18). El gen ND8, como se mencionó anteriormente, es un gen encriptado que debe ser editado para dar origen al transcrito que codifica para la 59

60 MARCO TEÓRICO proteína funcional (261). En la mayoría de los tripanosomátidos, como T. brucei, L. tarentolae, T. cruzi, Phytomonas serpens, C. fasciculata, Leptomonas seymouri, Wallaceina brevicula, W. inconstans y Herpetomonas samuelpessoai, el gen ND8 es un gen pan-editado (265, 266). Sin embargo, en otros tripanosomátidos como Strigomonas oncopelti (anteriormente Crithidia oncopelti), el gen ND8 solo se edita en su extremo 5 (254). Estudios recientes en tripanosomátidos de insectos, muestran un nuevo patrón de edición de ND8, consistente en la adición de 18 residuos de uridina en el extremo 5, con la particularidad de que el codón de inicio se codifica en el ADN directamente (265). Por su parte, en otras especies de Leishmania del nuevo y viejo mundo como en L. (L.) amazonensis (cepa LV78), se ha detectado un patrón completo de edición del gen, indicando que este transcrito puede ser funcional en esta especie (15). Por el contrario, en un derivado clonal (LdBob) de la cepa 1S de L. (L.) donovani, se determinó que el gen ND8 sufre un proceso de edición improductivo y no se encontraron diferencias en los niveles de expresión del ARNm pre-editado entre promastigotes y amastigotes (16). La existencia de los genes ND8 y su patrón de edición no ha sido descrito en L. (V.) braziliensis. 60

61 JUSTIFICACIÓN 5. JUSTIFICACIÓN En Colombia, L. (V.) braziliensis es una de las seis especies causante de leishmaniasis cutánea y mucocutánea, de mayor importancia (267), que afecta principalmente a individuos que residen en áreas rurales y de las Fuerzas Armadas (268). Entre 1995 y 2005 estudios realizados en el Instituto Nacional de Dermatología Federico Lleras Acosta mostraron una frecuencia de infección por L. (V.) braziliensis de 15,33 %, frente a 74,45 % de L. (V.) panamensis, 0,73 % de L. guyanensis y 5,11 % de L. (L.) mexicana. Así mismo, revelaron que la forma más frecuente de leishmaniasis es la cutánea (97,08 %), seguida de la muco-cutánea (2,19 %) y la difusa (0,73 %); siendo la LC causada en un 74,44 % por L. (V.) panamensis y en un 15,79% por L. (V.) braziliensis (269). Los últimos datos reportados por el Instituto Nacional de Salud, acerca de la situación de la leishmaniasis en Colombia, muestran que hasta la semana epidemiológica 40 del año 2011 se diagnosticaron casos de leishmaniasis cutánea y 113 de leishmaniasis mucosa (52). Los antimoniales pentavalentes constituyen el tratamiento convencional contra la leishmaniasis (4), seguido por anfotericina B, paromomicina, pentamidina y miltefosina. Sin embargo, la elevada toxicidad y el incremento en los casos de resistencia frente a su uso (5), aparte de otras consideraciones como el costo y la disponibilidad en el caso de la anfotericina B y la miltefosina (6-8), plantean la necesidad urgente de nuevos enfoques terapéuticos basados en el descubrimiento de nuevos blancos parasitarios (5, 7, 9). Sumado al anterior panorama, la falta de vacunas, es otro de los factores que dificulta el control de la infección. Las especies del género Leishmania que infectan al hombre, alternan entre dos organismos, un insecto vector y un hospedero mamífero, estando sometidas a ambientes altamente variables y hostiles (10). Sin embargo, el parásito es capaz de tolerar estos cambios, aún en ausencia de regulación transcripcional de su expresión génica. Para compensar esto, el parásito ha adoptado estrategias como 61

62 JUSTIFICACIÓN la duplicación génica, que le permite aumentar los niveles de expresión de genes importantes (242, 270). Durante la transición de promastigote (insecto-vector) a amastigote (hospedero mamífero), Leishmania también es capaz de modular su expresión génica mediante mecanismos post-transcripcionales que afectan la vida media de los ARNm o la eficiencia de su traducción. Mecanismos que dependen de la interacción entre motivos (cis-elementos) del ARNm localizados principalmente en las regiones 3 no traducidas (3 UTR) y factores proteicos reguladores (11-13). Entre los principales retos que deben asumir los parásitos del género Leishmania en su paso del insecto vector al hospedero mamífero, están: la generación de proteínas disfuncionales debido al estrés térmico, los cambios morfológicos que sufre el parásito en la transformación de promastigote a amastigote, el uso de nuevos recursos nutricionales y la adaptación a un ambiente con mayor potencial de óxido-reducción. Entre las proteínas que expresa el parásito para superar las condiciones ambientales adversas anteriormente descritas que ofrece el hospedero mamífero, están las proteínas HSP70, las - tubulinas y la subunidad ND8, respectivamente. Dada la necesidad de las anteriores proteínas para el mantenimiento del ciclo de vida del parásito en sus dos hospederos, el estudio de los mecanismos que aseguran la expresión de la HSP70, -tubulina y ND8 en Leishmania justo en el momento en que el parásito requiere de estas proteínas es de gran importancia, tanto desde el punto de vista del conocimiento básico, como para sentar bases para el desarrollo de medios de intervención dirigidos al control de las distintas patologías ocasionadas por estos parásitos. Puesto que el entendimiento de la regulación genica en tripanosomátidos, parte del conocimiento de la organización y arquitectura de sus genes, en este trabajo en primer lugar, se determinó la organización de los genes HSP70, - tubulina y ND8. Aunque el genoma de L. (V.) braziliensis se encuentra disponible, 62

63 JUSTIFICACIÓN éste no incluye la determinación de las secuencias UTR y en el caso de los genes repetidos (como los genes HSP70 y -tubulina), el número de copias puede ser impreciso debido a la dificultad que representa ensamblar secuencias repetidas. Adicionalmente, el genoma solo incluye secuencias nucleares, dejando excluidos los genes que se localizan en el genoma mitocondrial, como es el caso del gen ND8. En segundo lugar, en este estudio se determinó la expresión de los genes HSP70 y -tubulina tanto en condiciones normales de crecimiento, como en condiciones de choque térmico con el fin de simular el paso de promastigote a amastigote. Así mismo, en relación al gen ND8 se analizaron los productos de ADNc obtenidos por ensayos de retro-transcripción, para estudiar la edición del ARNm en los mismos. Finalmente, dada la importancia de las interacciones ARN/proteína, en los mecanismos de expresión génica de Leishmania, la identificación y caracterización de proteínas de unión a ARN podría conducir a una mayor comprensión de los mecanismos post-transcripcionales de regulación de la expresión génica en tripanosomátidos, así como al descubrimiento de nuevas dianas para el diseño de fármacos antiparasitarios. Con este objetivo, se aislaron mediante una estrategia de pull down seguida de electroforesis bidimensional y espectrometría de masas, proteínas de L. (V.) braziliensis de unión a las regiones 5 UTR, 3 UTR-I y 3 UTR-II de los ARNm codificantes para la proteína HSP70 del parásito como un primer paso hacia la elucidación de los factores proteicos que gobiernan la expresión de estas proteínas. 63

64 OBJETIVOS 6. OBJETIVOS 6.1 Objetivo general Caracterizar la organización genómica y expresión de los genes HSP70, - tubulina y ND8 de Leishmania braziliensis y detectar factores proteicos potencialmente implicados en la regulación de los genes HSP Objetivos específicos Objetivo específico 1 Caracterizar la organización genómica de los genes nucleares HSP70 y -tubulina y del gen mitocondrial ND8 de L. (V.) braziliensis Objetivo específico 2 Caracterizar la estructura y la expresión de los ARNm de los genes nucleares HSP70 y -tubulina y del gen mitocondrial ND8 de L. (V.) braziliensis Objetivo específico 3 Identificar factores proteicos potencialmente implicados en la regulación de la expresión de los genes HSP70 de L. (V.) braziliensis 64

65 MATERIALES, MÉTODOS Y RESULTADOS 7. MATERIALES, MÉTODOS Y RESULTADOS Los materiales, métodos y resultados de cada uno de los objetivos expuestos se presentan en los artículos a continuación de la siguiente forma: Objetivo específico 1 La caracterización de la organización de los genes HSP70, en el artículo No. 1 Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization La caracterización de la organización de los genes -tubulina en el artículo No. 2 Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression La caracterización de la organización del gen mitocondrial ND8 en el artículo No. 3 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis, comparación con otros tripanosomátidos Objetivo específico 2 La caracterización de la estructura y la expresión de los ARNm de los genes HSP70 se describe en el artículo No. 1 Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization La caracterización de la estructura y la expresión de los ARNm de los genes -tubulina se describe en el artículo No. 2 Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression La caracterización de la expresión de los ARNm del gen mitocondrial ND8 se describe en el artículo No. 4 Evidence of RNA editing in Leishmania braziliensis promastigotes 65

66 MATERIALES, MÉTODOS Y RESULTADOS Objetivo específico 3 Los factores proteicos potencialmente implicados en la regulación de la expresión de los genes HSP70 de L. (V.) braziliensis se presentan en el artículo No. 5 Identification of HSP70-RNA messenger interacting proteins in Leishmania braziliensis 66

67 MATERIALES, MÉTODOS Y RESULTADOS 7.1 Artículo No. 1 Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization 67

68 Ramírez et al. Parasites & Vectors 2011, 4:166 RESEARCH Open Access Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization César A Ramírez 1,2, José M Requena 2 and Concepción J Puerta 1* Abstract Background: The heat stress suffered by Leishmania sp during its digenetic life-cycle is a key trigger for its stage differentiation. In Leishmania subgenera two classes of HSP70 genes differing in their 3 UTR were described. Although the presence of HSP70-I genes was previously suggested in Leishmania (Viannia) braziliensis, HSP70-II genes had been reluctant to be uncovered. Results: Here, we report the existence of two types of HSP70 genes in L. braziliensis and the genomic organization of the HSP70 locus. RT-PCR experiments were used to map the untranslated regions (UTR) of both types of genes. The 3 UTR-II has a low sequence identity (55-57%) when compared with this region in other Leishmania species. In contrast, the 5 UTR, common to both types of genes, and the 3 UTR-I were found to be highly conserved among all Leishmania species (77-81%). Southern blot assays suggested that L. braziliensis HSP70 gene cluster may contain around 6 tandemly-repeated HSP70-I genes followed by one HSP70-II gene, located at chromosome 28. Northern blot analysis indicated that levels of both types of mrnas are not affected by heat shock. Conclusions: This study has led to establishing the composition and structure of the HSP70 locus of L. braziliensis, complementing the information available in the GeneDB genome database for this species. L. braziliensis HSP70 gene regulation does not seem to operate by mrna stabilization as occurs in other Leishmania species. Background The Leishmania genus involves about 20 species that infect humans, causing different clinical manifestations ranging from self-healing cutaneous lesions (CL), mucosal lesions (MCL) to fatal visceral infections (VL) [1]. More than 350 million people are considered at risk of contracting leishmaniases, and some 2 million new cases occur yearly [2]. In Latin America, CL and MCL are neglected public health problems endemic in 22 countries. Many species of the subgenus Viannia cause the majority of CL cases but MCL is principally caused by Leishmania (Viannia) braziliensis [3]. Canine leishmaniases, caused either by Leishmania infantum or by L. braziliensis, is also widespread in South America, being * Correspondence: cpuerta@javeriana.edu.co 1 Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Carrera 7 No , Edificio 52, Oficina 608, Bogotá, Colombia Full list of author information is available at the end of the article among the most important canine vector-borne diseases occurring in this region [4]. During its digenetic life cycle, the Leishmania parasite needs to adapt from the environmental (vector) temperature to the mammalian-host temperature (37 C). As a result, the heat shock response is induced and the heat shock proteins (HSPs) are expected to play important roles in the adaptation process, influencing the developmental change from promastigotes in sandflies to amastigotes in mammalian hosts [5-10]. Among HSPs,HSP70isthemosthighlyconservedinboth sequence and function. Proteins of the HSP70 family are central components of many fundamental cellular processes, including the folding and assembly of newly synthesized proteins, refolding of misfolded and aggregated proteins, membrane translocation of organellar and secretory proteins, proteolytic degradation of unstable proteins, and control of regulatory protein activity [11-14] Ramírez et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

69 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 2 of 11 Two classes of HSP70 genes, HSP70-I and HSP70-II, sharing the 5 untranslated region (UTR) and the coding region but differing in their 3 UTR, have been described in several Leishmania species like L. infantum, Leishmaniamajor,Leishmaniatropica,Leishmaniamexicana and Leishmania amazonensis [15,16]. In general, these genes are arranged in a single genomic cluster that contains five or six HSP70-I copies, followed by one HSP70- II copy. In L. infantum, it has been demonstrated that whereas HSP70-I mrnas accumulate in response to heat shock treatment, and are translated at both 26 and 37 C, HSP70-II mrnas do not show a temperaturedependent accumulation, but show preferential translation at heat shock temperatures [15]. Given that Leishmania genes are transcribed into polycistronic RNA precursors that need to be further processed into individual mrnas by trans-splicing and polyadenylation, post-transcriptional regulation represents the main level of controlling gene expression in these parasites [17]. Currently, multiple efforts are being dedicated to identify cis- and trans-elements involved in the modulation of mrna processing, mrna stabilization/destabilization, mrna half-life, or translation efficiency. Although regulatory sequences have been identified in both 5 and 3 UTRs, most of them have been located in the 3 UTRs [18-23]. For instance, preferential translation of HSP83 in Leishmania requires a thermosensitive polypyrimidine-rich element (PPT) in the 3 UTR [24]. Our knowledge on the organization and expression of HSP70 genes in Leishmania species of the subgenus Viannia is scanty. Although, the sequence for the L. braziliensis genome has recently been published [25], unfortunately, the genomic sequence found in the GeneDB database presents several gaps that hinder to elucidate the organization of the HSP70 locus in L. braziliensis. Moreover, in a preliminary work, it was documented by hybridization assays the existence of HSP70-I genes in L. braziliensis, but evidence on the presence of HSP70-II genes was not obtained [16]. In this work, we have determined the 5 and 3 UTRs for the HSP70 L. braziliensis genes, demonstrating the existence of the HSP70-II gene in this Viannia species, and established the organization of the HSP70 locus. Also the expression of both types of HSP70 genes was assessed. Methods Parasite cultures Promastigotes of L. braziliensis (MHOM/BR/75/M2904) were cultured in vitro at 26 C in Schneiders`s insect medium (Sigma Aldrich, Inc., St. Louis, USA) supplemented with 20% heat-inactivated fetal calf serum (Eurobio, Inc., Les Ulis, France), and 0.1 μg/ml of 6- Biopterin (Sigma Aldrich, Inc., St. Louis, USA). For heat shock treatments, 10 ml-aliquots of L. braziliensis promastigote cultures at logarithmic phase ( promastigotes ml -1 ) were transferred into 50 ml flasks, and incubated at 32 C, 35 C or 37 C for two hours. Afterwards, parasites were harvested for DNA or RNA extraction. Southern and Northern blot analyses Total DNA from L. braziliensis cells was isolated using the phenol-chloroform-isoamilic alcohol method [26]. Two μg of DNA were digested with several restriction enzymes according to the manufacturer specifications (Promega, Inc., Madison, WI, USA), electrophoresed on 0.8% low electroendosmosis agarose gels (Conda Pronadisa, Inc., Madrid, Spain), and transferred to nylon membrane (Roche, Inc., Mannheim Germany) by standard methods [26]. Total RNA from promastigotes was isolated using the Total Quick RNA Cells and Tissues (TALENT, Inc., Trieste, Italy). Four μg perlinewere separated on 1.5% (w/v) low electroendosmosis agarose/ MOPS/formaldehyde gels and transferred to nylon membranes. L. braziliensis chromosomes were prepared from promastigotes, harvested during log phase, washed and embedded in 0.6% low melting agarose (GIBCO BRL, Inc., N.Y, USA) plugs, which were finally soaked in a lysis solution (0.5 M EDTA, ph 9; 1% SDS, 1 mg/ml proteinase K) at 50 C during 48 h. After three washes with 0.2 M EDTA for 2 h each one, the blocks were loaded directly into the wells of 1% agarose NA gel (Amersham Bioscience, Inc., Uppsala, Sweden), sealed in place, separated by pulsed homogeneous electric field gel electrophoresis (PFGE) using a Pharmacia Biotech Gene Navigator apparatus at 100 V, 120 separation angle and switch times varying from 100 s/7 h; 200 s/10 h and 500 s/20 h, and transferred to nylon membranes. The following probes were used: 3 UTR-I (clone ptlb3hsp70-d, SmaI/EcoRI digested), 3 UTR-II (clone ptlb3h70-11b, HincII/EcoRI digested), and intercoding (IR-HSP70, clone plbhsp70-ir-e, PstI digested). They were labeled with digoxigenin by randomly primed synthesis using the DIG High Prime DNA Labeling kit (Roche, Inc., Mannheim, Germany). Hybridizations and immunological detection were performed using the Detection Starter kit II (Roche, Inc., Mannheim, Germany) according to manufacturer s instructions. Finally, membranes were exposed on Curix RP2 plus medical X-Ray film (AGFA, Mortsel, Belgium). Cloning UTR sequences and in silico analyses First-strand cdna synthesis was carried out from L. braziliensis total RNA using an oligo-dt primer and a cdna synthesis kit (LKB Pharmacia, New Jersey, USA). Amplification of the UTRs was performed from poly-t

70 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 3 of 11 primed-cdna using specific primers: LbSL (5 CGCTA TATAAGTATCAGTTTC3 ) and Lb181 (5 TGCAACC CGATCATGACCAAG 3 ) forthe5 UTR, and Lb1824 (5 GATCATGACCAAGATGTACCAGAG 3 ) and Poly T EcoRI (5 CGGAATTCTTTTTTTTTTTTTTTTTTT 3 ) for the 3 UTR-I (see Additional file 1). Briefly, 20 μl reactions containing 2 μl of cdna, 1X reaction buffer (10mMTris-HClpH9.0,50mMKCl,0.1%TritonX- 100), 1.5 mm MgCl 2, 0.7 mm of dntp mix, 0.2 μm of each primer, 2 M betain, and 0.06 units per μl of expand high fidelity enzyme (Roche, Branford, USA) were prepared. For 3 UTR-II amplification, 1 mm MgCl 2 and 0.5 μm of each primer were used. An MJ Research PTC-100 DNA thermocycler was used for the reaction with the following amplification profile: 95 C/5 min (initial denaturation), 35 cycles at 92 C/0.5 min, 58 C/0.5 min and 72 C/1 min, with a final incubation at 72 C for 10 min. All the amplified fragments were resolved in agarose gels and visualized under UV exposure after ethidium bromide staining. RT-PCR products were excised from gels, purified using GFX Gel Band Purification kit (Amersham Biosciences, GE Healthcare, Chalfont St. Giles, Buckinghamshire, England) and cloned in the pgem -T Easy plasmid (Promega, Madison, WI, USA); pcr II (Invitrogen, California, USA) or pcr2.1 (Invitrogen, California, USA) plasmids. The following clones were obtained: plbhsp70-5b containing the 5 UTR, ptlb3hsp70-d for the 3 UTR-I, plb3h70-11b for the 3 UTR-II, and plbhsp70-ir-e for the intercoding region. The sequences were determined using the Big Dye Terminators v3.1 kit (Applied Biosystem, California, USA) by automatic sequencing at the Servicio de Genómica (Parque Científico de Madrid, Universidad Autónoma de Madrid). In order to deduce the HSP70 mrna UTRs from other Leishmania species LALIGN ( form.html) analyzes were performed. A ClustalW analysis ( for multiple alignments of sequences, were carried out to determine the similarity among them. Results and discussion The L. braziliensis HSP70 locus contains two types of HSP70 genes Gene structure and expression of the HSP70 protein have been well characterized in L. infantum [7,15,16,27] and other trypanosomatids of medical importance as L. major [28], Trypanosoma brucei [29,30], and Trypanosoma cruzi [31-36]; nonetheless, little is known about their genes in L. braziliensis. A previous study showed the presence of the HSP70-I genes in this parasite; however, it was not determined their copy number. These authors also reported that using the 3 UTR-II region from L. infantum as probe, it was not possible to detect the presence of HSP70-II genes in L. braziliensis [16]. In order to determine the genomic organization of HSP70 genes in L. braziliensis, we searched in the L. braziliensis genome database at GeneDB for entries containing HSP70 sequences. One complete HSP70 gene (GeneDB ID: LbrM28_v2.2990) and two incomplete sequences, LbrM28_v (bearing a 5 -fragment of the gene encoding the N-terminal region of HSP70) and LbrM28_v (encoding the C-terminal protein region) were found (Figure 1). Between both fragments of HSP70 genes, a sequence gap of undetermined length is annotated in the database. Even though LbrM28_v and LbrM28_v might be part of thesamegene,thesequencedregionsdonotoverlap. All three sequences are tandemly organized on the minus strand of chromosome 28. No other entries for HSP70 genes were found in the L. braziliensis database. This genomic organization of the HSP70 genes in L. braziliensis resembledthatfoundinotherleishmania species of the subgenus Leishmania, i.e. a locus containing tandemly repeated HSP70 genes [16]. However, L. braziliensis M2904 chromosome 28 LACK Gamma-tubulin complex subunit LbrM LbrM LbrM Hypothetical, unknown Hypothetical, conserved Figure 1 Location of HSP70 genes in the L. braziliensis genome. The upper black arrows demarcate the HSP70 locus. Red boxes indicate the 5 UTR, blue arrow the 3 UTR-I, green arrow the 3 UTR-II and red stars the gaps in the sequence. Current information on the L. braziliensis HSP70 locus at GeneDB database can be accessed through the link: 2FQuickSearchQuery#LbrM :mRNA

71 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 4 of 11 tandem gene arrays are among the most challenging to resolve correctly using current genome sequencing technology, since repetitive sequence reads tend to collapse into a single contig when no variation exists to distinguish them. Thus, in order to determine the copy number of HSP70 genes composing the locus, and possible sequence divergence existing between the different genes, we designed specific oligonucleotides to cloning the complete intercoding regions (UTRs+intergenic regions), from genomic DNA, and also the 5 - and3 - UTRs by RT-PCR from poly-a + RNA (see Methods section for further details). A single amplification fragment for the intercoding region was obtained and, after cloning, its sequence was found to be conserved (99.8% of sequence identity) with the sequence located between genes LbrM28_v and LbrM28_v These findings suggest a high conservation of intercoding regions in the HSP70 locus; however, a more accurate determination of degree of conservation would require the sequencing of several additional clones. On the other hand, using RT-PCR and specific oligonucleotides, it was possible to determine the 5 UTR sequence, which is 198 bp in length (Figure 2). This sequence has been deposited in the GenBank database under the accession number JF In spite of the high sequence identity, among the four sequences analyzed, two microsatellite length polymorphisms in the 5 -UTR were observed (see Additional file 2), suggesting the existence of allelic polymorphisms in the L. braziliensis HSP70 locus. In addition, the alignment of the 5 UTR with the genomic sequences allowed us to deduce A B 5 UTR 5 UTR 5 UTR 5 UTR 5 UTR 5 UTR 5 UTR 3 5 Lmj --GATCCTAAACACGCACTCGCACTCAAGCTGTCCGAAGATAACACATACGCGCACAGGC 58 Li --GATCCTAAACACGCACTCGCACTCAAGCTGTCCGAAGAGAACACATACGCGCACAGGC 58 Lmx ---GTCCTAAACACGCACTCGCACTCCAGCTGTCCGAAGAGAACACATACGCGCACAGGC 57 Lb AGGATCCTAAGCACGCAGTCTCGCTCACGCTCTCCTAAGAGAACACATACGCGCACAGCC 60 Lmj ATACGTCTCTCTCGCTCTGCGCTCTATTACGTAACCCTAGAAACACCCT------CCTCC 112 Li ATACGTCTCTCTCGCTCTGCGCTCTATTACGTAACCCTATAACCACCCT------CCTCC 112 Lmx ACACGTCTCTCTCGCTCTGCGCTCTATTACGTAACCCTATAAACACCCC------CCTCC 111 Lb ATACACCTCTCCTGTGCTGCACTCTATTGCGTAACCCTACAAACCCCCTTTCACACCTTC 120 Lmj TCCTCCCCACCCCCCACCCCCATCCT ACACGCACATACACAC 154 Li ----CCCCACC------CCCCATCCC ACACGCACATACACAC 144 Lmx CACACATACATAC 124 Lb CGGCGCCTATTTCACCGCCCCCCCCCCCACATACACACACACACACACACACGTACATAC 180 Lmj ACGACCACTGCCGCAGAG 172 Lin ACGACCACTGCCGCAGAG 162 Lmx ACCACCACTGCCGCAGAG 142 Lb ACTACCGCTGCTGCAGGG 198 Figure 2 Position and sequence of the 5 UTR of HSP70 cluster from L. braziliensis. (A). Graphical representation of the 5 UTR position in the HSP70 cluster of L. braziliensis. (B). Multiple sequence alignment among HSP70 5 UTR from L. braziliensis (Lb: JF449363), L. major (Lmj: LmjF ), L. infantum (Li: LinJ28_V3.2960) and L. mexicana (Lmx: LmxM ). Conserved sequences are shaded in gray. that the AG splicing acceptor is located 194 and 199 nucleotides upstream of the start codon of LbrM28_v and LbrM28_v genes, respectively. Also, in both entries, 28 nucleotides upstream of the splicing acceptor site, an identical polypyrimidine tract of 22 nucleotides in length (5 CTCCCCTTTCTCT CTCTGCCCC 3 ) with a U/C ratio of 0.62 is observed. It is likely that this polypyrimidine tract is relevant for the trans-splicing process. Furthermore, in the coding regions contained in clones plbhsp70-ir-e and plbhsp70-5b, two transitions of guanine by adenine were found. The first one causes a change of cysteine by tyrosine, and the other produces a change of glutamic acid by lysine in the encoded polypeptides (Additional file 2). This variability, together with the microheterogenicity detected in the 5 UTR, supports the existence of at least four HSP70 genes in the diploid genome of L. braziliensis; but this resulted to be an underestimation as we demonstrate below. Regarding the 3 UTR of HSP70 genes, two types of sequences were cloned and sequenced (GenBank JF and JF449365), showing a high sequence divergence each other. After sequence comparison, they could be assigned to the two types of 3 UTR (I and II) described in HSP70 genes of other Leishmania species (Figures 3 and 4). Thus, we determined that the 3 UTR type I is 936 nucleotides long, and would correspond to the LbrM28_v entry (and possibly other genes of the HSP70 gene cluster, see below), and the 3 UTR type II is 932 nucleotides long and would be associated with LbrM28_v entry. The 3 UTR-II was found 100% identical with the genomic sequence located downstream of LbrM28_v2.2970, whereas the 3 UTR-I had 99.1% of sequence identity with the sequence located downstream of LbrM28_v entry, suggesting that the cloned 3 UTR-I might correspond to other HSP70 gene in the cluster (see below). According to the 3 UTR-I sequence, the polyadenylation in the LbrM28_v transcript would occur after two adenines, and 187 bp upstream of the putative polypyrimidine tract previously mentioned. Regarding the LbrM28_v gene, the polyadenylation would take place, after an A-rich region of 11 residues, and 154 bp upstream of a C-rich polypyrimidine tract of 14 nucleotides in length and U/C ratio of 0.08 (5 CCCCC CCCCTCCCC 3 ). It is a common feature that the presence of adenosine residue precedes the polyadenylation sitesofalargenumberoftrypanosomemrnas[37].it is believed that poly(a) polymerases prefer an initial adenosine residue for attachment of the poly(a) tail, and the selection of the polyadenylation site would be strengthened by the presence of adenosine residues [38]. After determining the extent of the UTRs, it was possible to define the intergenic region (IR) within the L.

72 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 5 of 11 3 UTR- I 3 UTR- I 3 UTR- I 3 UTR- I 3 UTR-I 3 UTR-I 3 5 Figure 3 Graphical representation of the 3 UTR-I position in the HSP70 cluster of L. braziliensis. Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb ATCGCCCGAGTGCGCCGGAGGTGCTGCAGAGCGCCTGCTCACCTCGTCCCTGCTGGCTGCTCCAGCCTGCGGGGGTGAGGG------CTC ATCGCCCGAGTGCGCCGGAGGTGCTGCAGAGCACCTGCTCACCTCGTCCCTGCTGGCTGCTCCAGCCTGCGGGGGTGGGGGCTCTCTCTC ATCGCCCGAGCGCGCCGGTGGTGCCGCACTGCACTTGCTCACCTCGTCCCTGCTGGCTGCTCTAACCTGCGGGAGCGGGGA GCTCTGTGTGCACCAGCGGTGCTGTG TTCCGCG---CTGATG TCTCTTTCTTGCATCTTCGCTCTCCTGTGCGTGCTGATGTGTACTTGGGCGTGGTGGTGGGTGGTGTGCACCGCCGTTGCGCCG--GCGC TCTCTCTCTTGCGTCTTCGCTCTCCTTTGCGCGCTGATGTGTGCTTGGGTGTGGTGGTGGGTGGTGTGCACGGCCGTTGCGCCG--GCGC -CTCTCTCCCGCATCTCCGCTCTCCTTTGCGCGCCGATGTGGGCTCGCGTGTGGTGGTGGGTGGTGTGCACGGCCGCTGTGCCGCAGCGC TGTATGTGCG--TGTGG---TGGGAGAGG-GGCAGATGGTGCGCGCGGCCGTTGTGCCT--GCGC CGCTGCGGCTGTGGCGCGTGATACGGGGTTTGTGGCATGGACCATGGCATGAAGACCCAGAAGGCGCCACGCGGAGGAGGCGGCAGCCGC CGCTGCGGCTGTGGCGCGGGGTACGGGGTTTATGGCATGGATCATGGCATGAAGGCCCGGAAGGCGCCACGCGGAGGAGGCGGCGGCGGC CGCTGCGGCTGTGGCGCGTGGTACGGGGTTTGTGGCATGGATCATGGCATGAAGACCCGGAAGGCGCAACACG------GCGGCGGCGGC CGCGGCTGCGGTGGCACGTGGTACGAGGTTTGTGACACGGACCGTGGCATGAAGACCCGGAAGCGGCCACGCG GCGGC AGCGCGCAGGGGCATTGTGCACCTCCCTCCCCCCTTTCACCCCCCGATTCCTAGCAGATGCGAGCTGCCGGAGTGCGTGTGATGCGCGTG AGCGCGCAGGGACATTGTGCACC-CCCTCCCCCC CCCCAATCCCTAGCAGATGCGAGCTGCCGGAGTGCGTGTGATGCGCGTG GGCGCGCAGGGGCGTTGTGCACC----TCCCCCC AATCCGTGGCAGATGCGAGCTGCCGGAGTGCGTGTGATGCGTGTG GGTGCGCAAGGGCATGTT GTCTCCCC ACTCCCTGGCCCGGGCGGACTGCTGGGGTGCGTGTGATGTGCGGG TGAGCGCATCTGCTCGTTTGCGAGCGAGCATGGCGGGCGTGCGGCAGCGGCGGCGTGTTGGCCGGTAGTGGTGGAGAGGCGGCGTGCTGG TGAGCGCATCTGCTCGTTTGCGAGCGAACATGGCGGGAGCGCGGCAGCGGTGGCGTGTTGGCCGGTAGTGGTGGAGAGGCGGCGTGCTGG TGAGCGCATCTGCTCGTTTGCGAGCGAATATGGCGGGCGCGCGGCTGCGGCGGCGTGTTGGCCGGTAGTGGTGGAGAGGCGGCGTGCTGG GCGGGCGAGCATGGCGAGTTCGCTGATGCGGTTGCGTGTTGGTCGGTAATGGTGGAGAGGCGGCCTGCTGG CAGCTGTGTGTGTGTGTGT------ATGTGCGTGCGAAGCAGGTGTGCTCGGCGTGGAATGCCCGCACACACACTGCTGCGCAAGCACTG CAGCTGTGTGTGTGTGTGTGTGTGTATGTGCGTGCGAAGCAGGTGTGCTCGGCGCGGAATGCTCGCGCACACACCGCTGCGCAAGCACTG CAGCTGTGTGTGCGTGTAT GTGCGCGTGAAGCAGGTGTGCTCGGCGCGGAATGCTCGCACACACACCGCTGCGCAAGCACTG CAGCTCTGTGTGCGTGTCT GTGCGAAGCAAGTGTGCCCGGCACGGTATGCTCG--CACACACTGGTGCACAAGCACAG CCTCTATCGTTGGCCTCTGTGCTGCTGCTCTTCCTC----TACACTTCGCATGTGTGACTGGTGCGGTGTGCGTGTCCCTCCCGTGTGTG CCTCTATTGTCGGTCTCTGTGCTGCTGCTCTCCCTC----TACACTTCGCATGTGTGAATGGTGCGGCGTGCGTGTCCCTCCCGTGTGTG CCTCTATCGTCGGACTCTGTGCTGCTGCTCTCCCTCCCTGTACGCTTCGTACGTGTGACTGGTGCGGCGTGGGTGTCCCTCCCGCGTGTG CCTCTATCGTTGGTCTCTGTGTTGCGGCTCTCCCTC----TACGCTTCAAACGTGTGGCTGATGCAGCGTGTGTGTCCCTCTCGTGTGTG TGTGTGTGTGTGTGTGTATGTGTGTCTGTGCATCTCCTCGAACTGCACCGCCGCGGCTGAGGGCGCACACACGCAGTCCCATGTGCGCGT TGTGTGTGTG TGCATCTCCTCGAACTGCACCGCCGCGGCTGGGGGCGCACGCACGCTGTCCCGTGTGCGCGT TGTGTGTGTGTGTG TCTGTGCATCTCCTCGAACTGCACCGCCGCGGCTGAGGGCGCACGCACGCAGTCCCATGTCCGCGT TGTGTGTGTG CGT TGAGCGAGAGCGCTTGAGGCCGACCCTCTTTCCTCCCCCTACCCGTGTTCCGCGCTCCGTGTCCTACGACACCGACGAGGACCGCGCACA TGAGCGAGAGCGCTTGAGACCGACCCTCTTTCCTCCCCCTACCCGTGCTCCGCGCTCCGTGTCTTACGACACGGACCAGGACCGCGCATG TGAGCGAGAGCGCTTGAGACCGACCCTCTTTCCTCCCCCTACCCGTGTTCCGCCCTCCGTGTCCTGCGGCACGGACGAGGACCGCGCACA TGAGCGAGAGCGCATGAGACCGACTCTCTTTCCTCCCCCTACCCGTACTCTGCGCTCCGTGTTCAGTGACACCGGCGAGGGCCGTGCATA CGGCCAGCACTCACCCTGACTGCCCGCCGCG----CCTTTCTCTCCCTTGATGGAGTCCCTGTTAACCTTTACCGTCGCGCACGCACATG GGGCCAGCGCTCACCCCGACTGCCCGCCGCG----CCTCTCTCTCCCTTGATGGAGCTCCTGTTAACCTTTACCGTCGCGCACACACATG TGGACAGCACTCACCCTGACTGCCCGCCGCG----CCT--CTCTCCCTTGATGGAGCCCCTGTTAACCTTTGCCGTCGCGCACACGCATG CGGCCAGCACTCACCCTGAATGCGCGCTGCGTCCCCCTCTCCCTCCCTCAGCTGAAGCCCTATTAACTTTTACCGGCACGCAC CCGATGCCGCACCATCAGCGTACGGCATCCCCCTTCGCTTTTGTGCGTGCGCGTGTGCGCTTCTCCTT-TGTCTCTTCTCCTCCTTATTT CCGATGCCGCACCATCAGCGTACGGCATCCCCCTTCGTTTTTGTGTGTGCGCGTGTGTGCTTCTCCTT-TGCCTCTTCACCTCCTTATTT CCGATGCCGCGCCACCAGCGTACGGCATCCCCCTTCGCTTGTGTGCGTGCGCGTGTGCGCTTCGCCGT-TGTCTCTT---CTTCTTATTT -CGAG--AGGGCACACGGCGTCC--CCCCCCCCCCCGCTT----GCGTGTGCGTGTGC-CCTCTCGGTGCCTCTCTT-TTCTTCTTTCCT GCGGCAACTGTGCAGAGCGGGGGAGCGTCGCCGCCGGTGAGTCAGAGGGGAGACGGGG-AGGGAGACAGCGATGGAAGCACG-CCCCTCC GCGGCAACTCTGCAGAGCGGGGGAGCGCCGCTGCCGGTGACTCAAAGGGGAAACGGGGGAGGGAGACAGCGATGGAAGCACGCCCCCTCC GCGGCAACTGTGCAGAGCGGGGGAGA CGGTGAG GGGAGGGG CGCG----CCTC GTGGCAGCG--GATGCGCGGAGCGACTCCTCTACCTCTCGCCATCTTTCGCCCCACGTCCGCGTG CGCGCTCCCCCTCC CCTCGCTGTCTCCCCCCCCCTATGCCCCCTCTTCGCCTAT-CATTTCAGTCTTGAGTTTCATCGATAAGAAGGCCCGACTCCGCGAGTGC CCTCGCTGTCTCCTCCCCCCT---CCCCCTCTTCGCCTAT-CATTTCAATCTTGAGTTTCATCGATAAGAAGGCCCGACTCCGCGAGTGC CATCGCTG--TCCTCCCCCCT--CCCTCCTCTTCGCCTAT-CTTTTCAGTCTTGAGCTTCCTCGATAGGAAGGCCCGACTCCGCGAGTGC TGCCGCCTG-TCTTCCTCCCCTTCCCTCCTCCTCTGTTCCGTATTTCATTCCGGTGGTACATCGACAAGAAGG-ACGGCTCCGTGAGTGC Li CGACCTGTGCCCCCTCCCCCTT-CCTTAA 1172 Lmj CGGCCTGTGCCCCCTCCCCCTTTCCTTAA 1158 Lmx CGGCCTGTGCCCCCTCCCCCCT-CCTCAA 1093 Lb CGGCCTGTGCCCCCTTCCCCTT-CCTTAA 936 Figure 4 Multiple sequence alignment among HSP70 3 UTR-I from L. braziliensis (Lb: JF449364), L. major (Lmj: LmjF ), L. infantum (Li: LinJ28_V3.2960) and L. mexicana (Lmx). Conserved sequences are shaded in gray. L. major 3 UTR-I sequence was deduced by comparison with L. infantum and L. braziliensis 3 UTR-I sequences. Additional file 3, shows the sequence information, currently available in the GeneDB database, that was used for assembling of the putative L. mexicana 3 UTR-I sequence.

73 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 6 of 11 braziliensis HSP70 locus. The IR, not included in the mature mrna, is defined as the sequence beginning downstream of the polyadenylation site and ending immediately upstream of the spliced leader acceptor site of a downstream gene. Thus, the IR between LbrM and LbrM genes was found to be 237 nucleotides in length; this region was almost identical (99.6%) to that cloned for this work (plbhsp70-ir-e clone, GenBank accession number JF449366), suggesting a high degree of conservation of this region along the HSP70 cluster. Comparison of L. braziliensis HSP70 UTRs with their homologues in other Leishmania species The characterization of UTRs for L. braziliensis HSP70 genes (Figures 2, 3 and 4) has evidenced the existence of a remarkable conservation of the HSP70 locus along the genus Leishmania, extending previous studies [16] to a species of the Viannia subgenus. The 5 UTR cloned in this work was found to be highly conserved with the equivalent regions of the LbrM28_v and LbrM28_v genes (98% and 99.5%, respectively). The comparison with the HSP70 5 UTR of other Leishmania species showed also a remarkable sequence identity (77-81%). Noticeably, this region was well conserved among all Leishmania species analyzed except for two exclusive sequences of L. braziliensis (Figure 2). Comparison of the 3 UTR-I from L. braziliensis with those from other Leishmania species revealed identities between 71-73%. Furthermore, stretches of identical nucleotides are present in the 3 UTR-I in all the species analyzed (Figure 3 and 4). Again, it was found that L. braziliensis sequence is the most divergent among the analyzed sequences. Thus, the L. braziliensis 3 UTR-I lacks several regions common to the other Leishmania species; in particular, there are two important sequence gaps, of 60 and 77 nts, located at the beginning and the middle of the region, respectively (Figure 3 and 4). In contrast to the 3 UTR-I, the 3 UTR-II from L. braziliensis showed to be more divergent, having only a 55-57% of identity with the other species analyzed. Indeed, some sequences at the first half of the region were exclusive for L. braziliensis (Figure 5 and 6). Conversely, it was found that L. braziliensis sequence lacks several regions common to the other Leishmania species, especially in the second half of the region (Figure 5 and 6). Nevertheless, the presence of several short stretches of identical sequences among all the species analyzed was also found (Figure 5 and 6), suggesting a common evolutionarily origin. Expression analysis of HSP70 genes in L. braziliensis The identification of two divergent 3 UTR sequences for HSP70 genes in L. braziliensis and their comparison with the sequences in the GeneDB database allowed us to define the existence of two types of HSP70 genes, a question that remained to be solved [16]. Northern blot assays using different probes were performed in order to elucidate the expression of these genes in L. braziliensis. Using the IR-HSP70 probe, containing the complete 3 - UTR-I together with 5 -UTR and short fragment of the coding region, two hybridization RNA species of very similarsizewereobserved (Figure 7). In addition, a slight hybridizing fragment of about 5.6 kb was observed in all lanes, but its signal became stronger when parasites were incubated at 37 C; accumulation of additional high molecular RNA species was also observed with this treatment (Figure 7A). It is likely that those fragments are representing RNA precursors (pre-mrna), whose processing is disturbed by heat shock. The use of probes specific for 3 UTR-I and UTR-II allowed us to show the existence of both types of transcripts: the HSP70-II mrna, which corresponds to the upper RNA in figure 7A, and the HSP70-I mrna, which corresponds to the lower one. Of special interest, both types of transcripts did not show accumulation under heat shock treatment (Figure 7). Copy number and chromosomal location of HSP70 genes in L. braziliensis In order to estimate the number of HSP70 genes in the L. braziliensis locus, a Southern blot analysis was carried out (Figure 8). L. braziliensis total DNA was either totally or partially digested with selected restriction enzymes, and, after electrophoretic separation and transferring, hybridized with specific probes. A prominent 3.3-kb fragment was observed after digesting DNAs with either SmaI- or BamHI and hybridizing with the intercoding probe (H70-IR-E;Figure8A), indicating that indeed the HSP70 locus in L. braziliensis should consist of tandemly repeated genes with a repetition unit of 3.3-kb. Additional fragments, showing lower hybridizations signals, were interpreted as representing the boundaries of the locus (Figure 8A, 3 UTR-II 3 5 Figure 5 Graphical representation of the 3 UTR-II position in the HSP70 cluster of L. braziliensis.

74 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 7 of 11 Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb Li Lmj Lmx Lb ATCGCCCGAGTGCGCCGGAGTGCTGTGAAACTTCTGCTCGTGTTCGCGC--CGCTTTTTTTTTGCT-TCGCGAATGCGTGTAGG ATCGCTCGAGT GCTGTGAAACTTCACCCCACGTTTGCACTGCACTGTATGTTTACTCTTTCTATTGTGCCTAGG ATCGCCCGAGC GCTGTGAAACAGCCTCCCATGTATGCGCTGCATTTATTTTGTTCG----CCTGTAGGCCAAGG GCTCTGTGTGCACCAGCG GTGCTGTAGTGCT--CGCCGGTGAATGCCATATATCCTGCTCACGCCG-CTGATGTATGTCTGGG TGGTTTGTAGG-GCGCCGCTGCTATTCCCCGGGAATGCACACCACCACCTGATAGATTCTGTGTG TGTGCT---C TGATGTGCGGCTGCGCCTTTGCTGCTCCCCTGTAATGGACACCACCACTTGATAGATTGTGTGTGTCTTTGTGTT-TGCGTGCGCT---C TGATATGGGAG-GCGCCGTCCTTATTCCCGGGAAACGCACACCACCACTTGATAGATTTTCTCTG TGTGTGTGCT---C TGTTG-GCGGATGCGGGTTCGCTGATGCCGTGGAG-ATACTCCTCGAACTGATGGATATGGTGCTACTATGTCCTGTTCAGGTGTTTTTC TCTGTAGCTCTGCTGCGC-----TTTTTCGAGTGC----CGTCGCTC------CGCGTGTCGTTTG-TGTCTAT-----TCTGAATTTGT TCCGTCGCTCTGCCGCAC-----TGTGTCGAGTGT----CATGAGTG------CGCGTGTTGTTCGGTGTCTAT-----TGTGAATTA-T TCCGTCCCGCTGCCGCGC-----TCTCTCGACTGC----CGTCGTTC------TGCGTGTCGTGTG-TGTCTCG-----TCTGAAGTATC TGCCTTGCGTTGACGCGCGGGTGTCTTACAGTGGCGCTGCGACGCTCTCTCCTCGCATATGCGGCG-TGTCTCTGCGTGTGTGTATGTCT TCTACGTTTTT TTTCCGTTTTATTTCGGAAGACTTCCGCGTGCTAAATCC---CCCCTTTCCCCCGTAACC-CCCCTCCCCC TCTGCATTTTTGGTT-TGTTTTGAATCTTATTTCGGAAGACTTCCGCGCGCTAAATCCTCCCCCCCCCCCCCCATTCCC-CCCTTCCCCC TCTGTTTTTTTTCG-----TTTGGG--TTGTTTCAAAAGACCCCCGCGCGTTAATATCCTCCTCCCCCCAACACACACT-CTTCTCCCCC TTTATTTTTTTGTGTGTGTTTTATATTTTTCTCCTTTCGTACTAAGAGCGTTTGCTCACTCCTACCCACCCCACATTAAGCCCCTCCTCC TTTTTTTCTCTACG TCTGTTTCGCCTTATTT TATATATATATATAT---ATTATGGTACCGCCACC CTCCCCGCCCCCCGATAACTCTCCCTTCCCCCTTGTTTGTCTGCGTCCGTTTCGCTATATATATATATATGATATTATGGTATCGCCACG TTCCCGTAACTCCC---CCTCCCTACTCTTCCTTCTCTGCGTCAGGTTTGCCTCATATATATTTATATTATATTTTATGGTACCGCCACC CCTCTCCCCCTCCCG CATTTTGTTTTGTCT TCAAAAATTAGTTCTCTCTTTGTT-TCCCGCCCTC GCTCACGCTCTCGCATTCACA----GAGAGCCGTCCCTATCCACTCTTTCTCCCTCTTGTCCCTCACGCTGTCCATCGTACTAGCCACCC GCGCATGCTCTCGCATTCACA----GAGAGCCGTCTTTTTCCCCTCTCCCTCCCTCTTGTCCCTCAAGCTGTCCCTCGTACTACCCAGTC GCTCACCCTCTCGCGCACACACAGAGAGAGCCGTCCTTCTCCCCTCTCCCTCCCTCTTCTCCCTCACGCAGCCCCTCGTACTATTCACCC TCTCGGTGTCTTGCG----CA-----TGAACTCGCAGAGAGTCATCGCACACTCTCCTCTTCCTTAGTCTCTCCCTCTCTCTTTAACGCC CCTCCCGC--CCCTACTTTTCCGCTGTCGGTCTTTCTAGTCCACACTCAAATACCACAACCACGGTGCCTGCGGCGCTGTGGGTGTGCGT CCTCCCGG--CCCCACTTTTCCGCTGTCGGTCTTTCCAGTCCACACCCAACTACCACGGCCACAGTGCGTGCGGCACGTTGTGTGTGCGT CCCCCCACGTCCCCACTCTTGTGCTGTCGGTCTTTCTCGTCCACACCCAACTACCACAGCTACGGCGCGTGCAGCACTGTG--TCTACGT CCAACCTG TTGTCGTTCTGTCTT--CCACACCCCACTACTGCGGTCACGCTGCATGTG TGTGT TGGTGTGCACATGGCGGGCTTGTGGACTCTCTGTTTGTCGATCTCGTTCCCCTTCCACCAGTCG-CAGTTTACGCGCGAAGCCCTGCTGG TGGTGTGCACATTGCAGGCTTGTAGACTCTCTGTTTGTCGTTCTCGTTCCCCTTCCACCAGTCG-CAGTTGAGGCGCTAAGCCCTGCTGG TGGTGTGCACATTGCAGGCGTGTTGACTCTCTGTTTGTTATTCTCGTTCCCCTTCCACCAGTCG-CAGGATCCGTGCAACGCTCTGCTGA GTGTGGGCGCAGTGCCTTCTTGTGTTCTCTCTGTTT-----TCGCTTTCCCCTTCCACCCGTGGGCAGTAAAGGCGCATAAGCCTGTGCG CTGGTGCGCGAGGGAGGAGAGGCCCACCAGCCAGCGTGTGTGCCACACTCTCTGGCAGGG-TTGCTTGCCGGCTTTGTAGCTGAGGACGT CTGGTGCGCGAGGGAGGAGAGGCCCACTAGCCTGCGTGTGTGCTACACTCTCTGGTACAG-CTGCTTGCCAGCTGAGTAGCAGAGGACAT CTGGTGCGCGAGGGAGGAGAGGCCAACGAGCCTGCGTGTGTGCTACACTCTCTGGTAAGGTTTGCCTGCCAGCTTTGTAGCAGAGGACAT CTGGTGCGCGAGGGAGGAGAGGACAACGAGCCCGCCTGTCTGCTATAATCGCCGGTGAAG-TTGTTCGACACCTTCGCAGGAGAGGAAGT GGACAGATCACACCGTTGGGGGCGTAGAGAGAGGGAGCGTGCAG--TGGGTGAAAGCTCGGCAGGCGGGCGACGGCAGCGAGGATGCTCA GAATAGATCGCACCGTGGGAGGGGTAGAGAAAGGAAGTGTGCAGAGTGGGTGAAAGCTCGGCAGGCGGGCGACGGCAGCGAG GGATAGATCGCAGTGGTGGAGGCGTAGAGAGAGGGAGTGTGCAGTGTAGGTGAAAGCTCGGCAGGCGGGTGACGGCAGCGAGGATGCTCA GGATTGATCGCGGCGGTCGGGGCG--GAGAGAGGGAG CTGGTG--AGAAGGAAAAGAG CTGCACGTCTGCATCGAGGTGCGTGTGGATGCACGCAAGCCGCCTCAGCA---ATCTACGCGTCTGTGTGTGTGCGAGAGAGCGAATTAA GTGCACATGGATGCACGCAAGCTGGCTCAGCA---ATCTACGCGTCTGTGTGTGTGCGAGAGAGCGAATTAA CTGTAGGTCTGCATCGAGGTGCGTGTGGATGCACGCAAGCCGCCTCAGCAGCAATCTGCGCGTCTCTGTGTGTGCGAAAGGTCGAATCGA AGAAAGCATGCAG AGTGAGTGAGC AGAAGAG---AAGAAGAGAGACGACGGAAGTGCGCGCGCAAACCAGGAAAGCCAACCGGCTTCCACACCCACAAACCCCCCG-TCGCTTT AGAAGAGAACATGAAGAGAGACGACGGAAGTGCGCGAGCAAACCCGGAAGGCCAACGGGCTTCCACACCCGCAAACCCCCG--TCGCGTC AGAAGAGAATAAGAAGAGAGACGACGGAAGTGCTCGAGCAAGCATG-AAAGCAAACGGGCTTCCACACCCACAAGCCCCCCTGTCGCGTC ACTCGTTAGGCGGGCTTTGGCAG CGGGAATGCTCACCTGCATGTCTGCAG TGATTTCTCGTTGTCTGGCACTCACATCAGCTCTCTCCCT--GTCTCTCCTTTATGGAGCATGACGATACGGTAACATGCAGTGCGAGCA CGATCTCTCGTTTTCTGGCACTTACATGAGCTCTCTCCCTCTGTCTCTCCTTTATGGAGCATGTCGATACAGTAACATGCAGTGCGAGCA GAATCTCTCGTTGTCTGGCACTTAGGTCGGCTCCCTCCCTCTGTCTCTCCTTTGTGGAGCATGACGATACGGTAACATGCAGTGCAAGCA TGGAGGCTGGCGTTGATTCAGACAAGCCGCCAC-----CGCCATCTGTGCGTTTGTGGACGCGGGAGAAT------CAAAAA Li CTGGAAAA 1071 Lmj CTGGAAAA 1096 Lmx CTGGAAAA 1107 Lb AAAAAA Figure 6 Multiple sequence alignment among HSP70 3 UTR-II from L. braziliensis (Lb: JF449365), L. major (Lmj: LmjF ), L. infantum (Li: LinJ28_V3.3000) and L. mexicana (Lmx: LmxM ). Conserved sequences are shaded in gray. L. major and L. mexicana sequences were deduced by comparison with L. infantum and L. braziliensis 3 UTR-II sequences.

75 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 8 of 11 A B H70-3UTR-I probe Figure 7 Identification of HSP70-I and HSP70-II transcripts of L. braziliensis. Four micrograms of total RNA isolated from promastigotes incubated for 2 h at the indicated temperatures were separated on denaturant 1.5% agarose/mops/formaldehyde gel, blotted and hybridized with the H70-IR-E (A), 3 UTR-I, and 3 UTR-II (B) probes. As load control, the agarose gels were stained with ethidium bromide (rrna panels). A B C XhoI BamHI BamHI BamHI D BamHI BamHI BamHI XhoI BamHI SmaI SmaI SmaI SmaI SmaI SmaI 3 HSP70-II HSP70-I HSP70-I HSP70-I HSP70-I HSP70-I HSP70-I 5 XhoI / BamHI 4.18 kbp XhoI / SmaI 5.14 kbp 1515 bp H70-IR-E Probe SmaI / SmaI 3.3 kbp BamHI / BamHI 3.3 kbp SmaI / XhoI 3.8 kbp Figure 8 Genomic organization of HSP70 genes from L. braziliensis. DNA from promastigotes was totally or partially digested with restriction enzymes and the resulting fragments were separated on a 0.8% agarose gel, transferred to nylon membrane and hybridized with the H70-IR-E probe (A). The same blot was stripped and rehybridized with the HSP70-3 UTR-II probe (B). Lanes: 1, 185 ng of l DNA HindIII; 2, 300 ng of XhoIdigested DNA; 3, 1 μg ofxhoi+smai-digested DNA; 4, 1 μg ofxhoi+bamhi-digested DNA; 5 to 9, DNA digested with BamHI for 2 min (lane 5), 5 min (lane 6), 15 min (lane 7), 30 min (lane 8), and 3 hours (lane 9); lane 10, 140 ng of F29 DNA+HindIII. Molecular weight markers (lane 1 and 10) were labeled with digoxigenin and used as a probe in the hybridizations. (C) Pulsed field gel electrophoresis showing ethidium bromide staining of S. cerevisiae (lane 1), and L. braziliensis chromosomes (lane 2). Panel 3 shows the hybridization of the H70-IR-E probe to the L. braziliensis chromosomes. (D) Graphical representation of the deduced physical map for HSP70 locus in L. braziliensis. Small red boxes represent the 5 UTR; light blue boxes the 3 UTR-I, dark blue one the 3 UTR-II, and green boxes the ORFs.

76 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 9 of 11 lane 3, and 8B, lanes 3, and 4). The tandem organization of the locus was demonstrated by BamHI partial digestion of L. braziliensis DNA; a typical ladder was observed (Figure 8A, lanes 5 to 8). Hybridization of the membrane with the 3 UTR-II probe showed a sole hybridization fragment (5.1-kb in XhoI+SmaI digested DNA, and 4.1-kb in XhoI+BamHI digested DNA) (Figure 8B, lanes 3 and 4, respectively), in agreement with the existence of a unique HSP70-II gene, which was located at the 3 end of the locus (Figure 8D). According to the number of fragments observed in the lanes containing BamHI partially digested DNA (Figure 8A, lanes 5 to 8), and taking into account the size of the hybridizing XhoI-fragments which should contain the complete locus (Figure 8A, lane 2), it was estimated the presence of around seven HSP70 genes in the L. braziliensis HSP70 locus, as is shown in Figure 8D which summarizes the genomic organization of the L. braziliensis HSP70 locus. The presence of two hybridization fragments, larger than 20 kb, in the lane containing XhoI-digested DNA (Figure 8A, lane 2) has no direct explanation. Two hypotheses may be invoked to explain this unexpected finding. On the one hand, it can be postulated the existence of two identical HSP70 tandems that, furthermore, should be found in the same chromosome. Thus, PFGE separation and hybridization assays showed that HSP70 genes are located in a chromosome of approximately 1.5 Mb (Figure 8C), which would correspond to the chromosome 28, according to the location of the HSP70 locus in the GeneDB database. The other hypothesis is the existence of allelic polymorphisms either within the locus (affecting the number of HSP70 gene copies) or in its boundaries (affecting one of the XhoI restriction sites). Although the size and hybridization intensity of these XhoI restriction fragments supports the second alternative, and the resolution of the PFGE assay do not permit distinguish between the two size different sister chromosomes, further work is needed to clarify this finding. Conclusions The present work was intended to establish the genomic organization of HSP70 genes in L. braziliensis. Firstly, by RT-PCR and cloning, we identified two types of 3 UTR sequences, demonstrating that also in L. braziliensis two types of HSP70 genes exist, a feature shared with other Leishmania species. In addition, our analyses support the existence of at least seven HSP70 genes arranged in a head-to-tail manner. In summary, the HSP70 locus in L. braziliensis, like in Leishmania subgenus species, is composed of the two types of genes (HSP70-I and HSP70-II), the number and the relative position of these genes being very similar in the Leishmania genus. This finding is of especial value taking into account that L. (V.) braziliensis complex is considered as the earliest divergent species of the genus Leishmania [39]. The strict conservation of the HSP70 gene array in all Leishmania species analyzed suggests that this type of arrangement must have an important functional role. Indeed, as recently reported, the HSP70-II gene in L. infantum is extremely relevant for virulence and intracellular survival of the parasite [40]. Additionally, we have experimentally mapped the 5 and 3 UTR of both types of HSP70 genes of L. braziliensis. After comparing with the genomic sequences, the position of processing signals, such as the trans-splicing and polyadenylation sites as well as the C-rich polypyrimidine tracts, were determined. The distance between these elements is in agreement with previously reported range of distances [41]. Former studies in L. braziliensis reported that after probing the mrna blot with the HSP70 coding region, two hybridization RNA species very close in size were observed, corresponding the lower molecular weight species to that hybridizing with a 3 UTR-I probe [16]. Our Northern blot analysis supported these findings and revealed that the larger RNA corresponds to the HSP70- II transcript, confirming the existence of the HSP70-II genes in this parasite. Although, the size difference between these transcripts could not be explained by the sole difference in size of both 3 UTRs, it is likely that the differences are due to different length of the poly(a) tail [42,43]. Noticeably, it is considered that unstable mrnas carry shorter poly (A) tails [44,45]. Northern blot assays showed that the steady-state levels of both transcripts are not affected by the temperature of incubation. Consequently, in contrast to the species of the Leishmania subgenus, L. braziliensis HSP70-I transcripts are not stabilized upon heat shock. Additional material Additional file 1: Strategy for cloning the intercoding and UTR regions of L. braziliensis HSP70 genes. (A) Location of the primers according to the L. braziliensis genome database. (B) Amplification of the intercoding region using the Lb1817F/Lb181R primers (plbhsp70-ir-e clone). (C) Total RNA was extracted and cdna synthesized with polyt- EcoRI primer. The cdna was used as template to amplify the 5 UTR, using the LbSLF and Lb181R primers (plbhsp70-5b clone), or 3 UTRs, using the Lb1824F and polyt-ecori primers. ptlb3hsp70-d, and plb3h70-11b clones correspond to 3 UTR-I, and 3 UTR-II, respectively. Additional file 2: CLUSTAL 2.1 multiple sequence alignment between the sequence of plbhsp70-5b clone and the equivalent sequences present in plbhsp70-ir-e clone, and genes LbrM28_V and LbrM28_V Shaded in grey is the start codon; LbrM28_V gene has in the 5 UTR an additional cytosine in position 138 (in bold); the 5 UTR from LbrM28_V gene contains four nucleotide gaps (underlined in the other sequences). In position 248 (shaded in green) of plbhsp70-ir-e sequence, within the coding sequence, there is a G to A transition that generates a change of cysteine (C) by tyrosine (Y) in the protein. In position 340 (shaded in fuchsia) of plbhsp70-5b sequence, there is other transition of a guanine

77 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 10 of 11 for an adenine that generates a change of Glutamic acid (E) by Lysine (K). Additional file 3: Location of HSP70 genes in the L. mexicana genome. The upper black arrows demarcate the HSP70 locus. Red boxes indicate the 5 UTR, blue arrows the 3 UTR-I, green arrow the 3 UTR-II, and red stars the gaps in the sequence. L. mexicana 3 UTR-I sequence was assembled from three fragments (GeneDB positions: ; , and ) deduced by comparison of the L. mexicana genome with the GenBank entry L , a sequence containing the 3 UTR-I from L. mexicana amazonensis. L. mexicana 3 UTR-II sequence was deduced by comparison with L. infantum and L. braziliensis 3 UTR-II sequences. Abbreviations CL: cutaneous leishmaniasis; MCL: muco-cutaneos leishmaniasis; HSP: heat shock protein; HSP70: 70 kda heat shock protein; IR: Intergenic region; PFGE: pulsed field gel electrophoresis; PPT: thermosensitive polypyrimidine-rich element; UTR: untranslated region; VL: visceral leishmaniasis; LACK: activated protein kinase c receptor (guanine nucleotide-binding protein beta subunitlike protein). Acknowledgements CJP s lab was supported by Colciencias (Colombia), Research project No JMR s lab was supported by grants from the Ministerio de Ciencia y Tecnología (BFU ) and the Fondo de Investigaciones Sanitarias (ISCIII-RETIC RD06/0021/0008-FEDER). CAR was supported by Colciencias, Programa Nacional de Doctorados, convocatoria Author details 1 Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Carrera 7 No , Edificio 52, Oficina 608, Bogotá, Colombia. 2 Centro de Biología Molecular Severo Ochoa (CSIC-UAM), Universidad Autónoma de Madrid, Madrid, Spain. Authors contributions CAR, JMR, and CJP conceived and designed the experiments. CAR performed the experiments. CAR, JMR, and CJP analyzed the data. CAR, JMR, and CJP wrote the paper. All authors revised and approved the final version of the manuscript. Competing interests The authors declare that they have no competing interests. Received: 12 July 2011 Accepted: 26 August 2011 Published: 26 August 2011 References 1. Murray HW, Berman JD, Davies CR, Saravia NG: Advances in leishmaniasis. Lancet 2005, 366(9496): Control of the leishmaniases. [ WHO_TRS_949_eng.pdf]. 3. Oddone R, Schweynoch C, Schonian G, de Sousa Cdos S, Cupolillo E, Espinosa D, Arevalo J, Noyes H, Mauricio I, Kuhls K: Development of a multilocus microsatellite typing approach for discriminating strains of Leishmania (Viannia) species. J Clin Microbiol 2009, 47(9): Dantas-Torres F: Canine leishmaniosis in South America. Parasit Vectors 2009, 2(Suppl 1):S1. 5. Shapira M, McEwen JG, Jaffe CL: Temperature effects on molecular processes which lead to stage differentiation in Leishmania. EMBO J 1988, 7(9): Maresca B, Kobayashi GS: Hsp70 in parasites: as an inducible protective protein and as an antigen. Experientia 1994, 50(11-12): Quijada L, Soto M, Alonso C, Requena JM: Analysis of post-transcriptional regulation operating on transcription products of the tandemly linked Leishmania infantum hsp70 genes. J Biol Chem 1997, 272(7): Krobitsch S, Clos J: A novel role for 100 kd heat shock proteins in the parasite Leishmania donovani. Cell Stress Chaperones 1999, 4(3): Zilka A, Garlapati S, Dahan E, Yaolsky V, Shapira M: Developmental regulation of heat shock protein 83 in Leishmania. 3 processing and mrna stability control transcript abundance, and translation id directed by a determinant in the 3 -untranslated region. J Biol Chem 2001, 276(51): Bente M, Harder S, Wiesgigl M, Heukeshoven J, Gelhaus C, Krause E, Clos J, Bruchhaus I: Developmentally induced changes of the proteome in the protozoan parasite Leishmania donovani. Proteomics 2003, 3(9): Hartl FU: Molecular chaperones in cellular protein folding. Nature 1996, 381(6583): Bukau B, Horwich AL: The Hsp70 and Hsp60 chaperone machines. Cell 1998, 92(3): Mayer MP, Bukau B: Hsp70 chaperones: cellular functions and molecular mechanism. Cell Mol Life Sci 2005, 62(6): Folgueira C, Requena JM: A postgenomic view of the heat shock proteins in kinetoplastids. FEMS Microbiol Rev 2007, 31(4): Folgueira C, Quijada L, Soto M, Abanades DR, Alonso C, Requena JM: The translational efficiencies of the two Leishmania infantum HSP70 mrnas, differing in their 3 -untranslated regions, are affected by shifts in the temperature of growth through different mechanisms. J Biol Chem 2005, 280(42): Folgueira C, Canavate C, Chicharro C, Requena JM: Genomic organization and expression of the HSP70 locus in New and Old World Leishmania species. Parasitology 2007, 134(Pt 3): Requena JM: Lights and shadows on gene organization and regulation of gene expression in Leishmania. Front Biosci 2011, 17: Charest H, Zhang WW, Matlashewski G: The developmental expression of Leishmania donovani A2 amastigote-specific genes is posttranscriptionally mediated and involves elements located in the 3 - untranslated region. J Biol Chem 1996, 271(29): Mishra KK, Holzer TR, Moore LL, LeBowitz JH: A negative regulatory element controls mrna abundance of the Leishmania mexicana Paraflagellar rod gene PFR2. Eukaryot Cell 2003, 2(5): Larreta R, Soto M, Quijada L, Folgueira C, Abanades DR, Alonso C, Requena JM: The expression of HSP83 genes in Leishmania infantum is affected by temperature and by stage-differentiation and is regulated at the levels of mrna stability and translation. BMC Mol Biol 2004, 5: Purdy JE, Donelson JE, Wilson ME: Leishmania chagasi: the alpha-tubulin intercoding region results in constant levels of mrna abundance despite protein synthesis inhibition and growth state. Exp Parasitol 2005, 110(2): Zick A, Onn I, Bezalel R, Margalit H, Shlomai J: Assigning functions to genes: identification of S-phase expressed genes in Leishmania major based on post-transcriptional control elements. Nucleic Acids Res 2005, 33(13): Holzer TR, Mishra KK, LeBowitz JH, Forney JD: Coordinate regulation of a family of promastigote-enriched mrnas by the 3 UTR PRE element in Leishmania mexicana. Mol Biochem Parasitol 2008, 157(1): David M, Gabdank I, Ben-David M, Zilka A, Orr I, Barash D, Shapira M: Preferential translation of Hsp83 in Leishmania requires a thermosensitive polypyrimidine-rich element in the 3 UTR and involves scanning of the 5 UTR. RNA 2010, 16(2): Peacock CS, Seeger K, Harris D, Murphy L, Ruiz JC, Quail MA, Peters N, Adlem E, Tivey A, Aslett M, et al: Comparative genomic analysis of three Leishmania species that cause diverse human disease. Nat Genet 2007, 39(7): Sambrook JRD: Molecular Cloning: A Laboratory Manual. New York;, Quijada L, Soto M, Alonso C, Requena JM: Identification of a putative regulatory element in the 3 -untranslated region that controls expression of HSP70 in Leishmania infantum. Mol Biochem Parasitol 2000, 110(1): Lee MG, Atkinson BL, Giannini SH, Van der Ploeg LH: Structure and expression of the hsp 70 gene family of Leishmania major. Nucleic Acids Res 1988, 16(20): Hausler T, Clayton C: Post-transcriptional control of hsp70 mrna in Trypanosoma brucei. Mol Biochem Parasitol 1996, 76(1-2): Lee MG: The 3 untranslated region of the hsp 70 genes maintains the level of steady state mrna in Trypanosoma brucei upon heat shock. Nucleic Acids Res 1998, 26(17):

78 Ramírez et al. Parasites & Vectors 2011, 4:166 Page 11 of Engman DM, Sias SR, Gabe JD, Donelson JE, Dragon EA: Comparison of HSP70 genes from two strains of Trypanosoma cruzi. Mol Biochem Parasitol 1989, 37(2): Requena JM, Lopez MC, Jimenez-Ruiz A, de la Torre JC, Alonso C: A headto-tail tandem organization of hsp70 genes in Trypanosoma cruzi. Nucleic Acids Res 1988, 16(4): Requena JM, Lopez MC, Jimenez-Ruiz A, Morales G, Alonso C: Complete nucleotide sequence of the hsp70 gene of T. cruzi. Nucleic Acids Res 1989, 17(2): Requena JM, Jimenez-Ruiz A, Soto M, Assiego R, Santaren JF, Lopez MC, Patarroyo ME, Alonso C: Regulation of hsp70 expression in Trypanosoma cruzi by temperature and growth phase. Mol Biochem Parasitol 1992, 53(1-2): de Carvalho EF, de Castro FT, Rondinelli E, Soares CM, Carvalho JF: HSP 70 gene expression in Trypanosoma cruzi is regulated at different levels. J Cell Physiol 1990, 143(3): Rodrigues DC, Silva R, Rondinelli E, Urmenyi TP: Trypanosoma cruzi: modulation of HSP70 mrna stability by untranslated regions during heat shock. Exp Parasitol 2010, 126(2): Matthews KR, Tschudi C, Ullu E: A common pyrimidine-rich motif governs trans-splicing and polyadenylation of tubulin polycistronic pre-mrna in trypanosomes. Genes Dev 1994, 8(4): Stiles JK, Hicock PI, Shah PH, Meade JC: Genomic organization, transcription, splicing and gene regulation in Leishmania. Ann Trop Med Parasitol 1999, 93(8): Momen H, Cupolillo E: Speculations on the origin and evolution of the genus Leishmania. Mem Inst Oswaldo Cruz 2000, 95(4): Carrion J, Folgueira C, Soto M, Fresno M, Requena JM: Leishmania infantum HSP70-II null mutant as candidate vaccine against leishmaniasis: a preliminary evaluation. Parasit Vectors 2011, 4(1): LeBowitz JH, Smith HQ, Rusche L, Beverley SM: Coupling of poly(a) site selection and trans-splicing in Leishmania. Genes Dev 1993, 7(6): Dewannieux M, Heidmann T: Role of poly(a) tail length in Alu retrotransposition. Genomics 2005, 86(3): van Leeuwen HC, Liefhebber JM, Spaan WJ: Repair and polyadenylation of a naturally occurring hepatitis C virus 3 nontranslated region-shorter variant in selectable replicon cell lines. J Virol 2006, 80(9): Shapira M, Zilka A, Garlapati S, Dahan E, Dahan I, Yavesky V: Post transcriptional control of gene expression in Leishmania. Med Microbiol Immunol 2001, 190(1-2): Schwede A, Ellis L, Luther J, Carrington M, Stoecklin G, Clayton C: A role for Caf1 in mrna deadenylation and decay in trypanosomes and human cells. Nucleic Acids Res 2008, 36(10): doi: / Cite this article as: Ramírez et al.: Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization. Parasites & Vectors :166. Submit your next manuscript to BioMed Central and take full advantage of: Convenient online submission Thorough peer review No space constraints or color figure charges Immediate publication on acceptance Inclusion in PubMed, CAS, Scopus and Google Scholar Research which is freely available for redistribution Submit your manuscript at

79 MATERIALES, MÉTODOS Y RESULTADOS 7.2 Artículo No. 2 Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression 79

80 Ramírez et al. BMC Genomics 2013, 14:454 RESEARCH ARTICLE Open Access Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression César A Ramírez 1,2, José M Requena 2 and Concepción J Puerta 1* Abstract Background: Alpha tubulin is a fundamental component of the cytoskeleton which is responsible for cell shape and is involved in cell division, ciliary and flagellar motility and intracellular transport. Alpha tubulin gene expression varies according to the morphological changes suffered by Leishmania in its life cycle. However, the objective of studying the mechanisms responsible for the differential expression has resulted to be a difficult task due to the complex genome organization of tubulin genes and to the non-conventional mechanisms of gene regulation operating in Leishmania. Results: We started this work by analyzing the genomic organization of α-tubulin genes in the Leishmania braziliensis genome database. The genomic organization of L. braziliensis α-tubulin genes differs from that existing in the L. major and L. infantum genomes. Two loci containing α-tubulin genes were found in the chromosomes 13 and 29, even though the existence of sequence gaps does not allow knowing the exact number of genes at each locus. Southern blot assays showed that α-tubulin locus at chromosome 13 contains at least 8 gene copies, which are tandemly organized with a 2.08-kb repetition unit; the locus at chromosome 29 seems to contain a sole α-tubulin gene. In addition, it was found that L. braziliensis α-tubulin locus at chromosome 13 contains two types of α-tubulin genes differing in their 3 UTR, each one presumably containing different regulatory motifs. It was also determined that the mrna expression levels of these genes are controlled by post-transcriptional mechanisms tightly linked to the growth temperature. Moreover, the decrease in the α-tubulin mrna abundance observed when promastigotes were cultured at 35 C was accompanied by parasite morphology alterations, similar to that occurring during the promastigote to amastigote differentiation. Conclusions: Information found in the genome databases indicates that α-tubulin genes have been reorganized in a drastic manner along Leishmania speciation. In the L. braziliensis genome database, two loci containing α-tubulin sequences were found, but only the locus at chromosome 13 contains the prototypic α-tubulin genes, which are repeated in a head-to-tail manner. Also, we determined that the levels of α-tubulin mrnas are down-regulated drastically in response to heat shock by a post-transcriptional mechanism which is dependent upon active protein synthesis. Keywords: Leishmania braziliensis, α-tubulin, Expression, Untranslated region * Correspondence: cpuerta@javeriana.edu.co 1 Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Carrera 7 No , Edificio 52, Oficina 608, Bogotá, Colombia Full list of author information is available at the end of the article 2013 Ramírez et al.; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

81 Ramírez et al. BMC Genomics 2013, 14:454 Page 2 of 12 Background Alpha tubulin, a highly conserved protein along the eukaryotic evolutionary tree, interacts with β-tubulin conforming an α/β-tubulin heterodimer that comprises the structural subunit of microtubules, the basic building structure of the cytoskeleton, which is responsible for cell shape and is involved in many essential processes, including cell division, ciliary and flagellar motility and intracellular transport [1]. In unicellular microorganisms the cell shape and form are particularly relevant and depend on morphogenetic processes affecting essentially to the internal cytoskeleton. On the other hand, these microorganisms, and particularly the trypanosomatid flagellates, are very adequate models for studying the morphogenetic processes mediated by cytoskeleton reorganizations [2], as many aspects of their biology (infectivity and transmission) depend on these processes. The Leishmania genus comprises at least 20 Leishmania species that infect humans, and the spectrum of diseases that they cause can be categorized broadly into three types: self-healing cutaneous leishmaniasis (CL), mucocutaneous leishmaniasis (MCL), and the often fatal visceral leishmaniasis (VL) [3]. Endemic leishmaniasis transmissions have been reported in 98 countries on 5 continents, and around two million new cases of leishmaniasis occur each year [4]. There are two major developmental forms in Leishmania, the motile promastigote and the amotile amastigote. Classical studies demonstrated that the promastigote stage synthesizes more tubulin protein than the amastigote stage, and that this biosynthetic change of tubulin was found to correlate with the morphological change of microtubules in leishmanial flagella and cytoskeleton during promastigote-to-amastigote transformation [5]. Studies aimed to uncover the regulation responsible for the differential expression of tubulin genes were initiated shortly after [6], but this has resulted to be a difficult task due to the complex genome organization of tubulin genes [7], in particular, and to the non-conventional mechanisms of gene regulation operating in Leishmania [8]. In various Leishmania species, the genomic organization of α- and β-tubulin genes has been analyzed, showing the existence of multiple copies, both arranged in tandem (forming separate clusters of α- and β-tubulin genes) and dispersed in the genome [7,9,10]. The availability of the genome sequences for several Leishmania species [11-13] has allowed resolving questions regarding the genome organization of complex gene families. In a recent work, Jackson and co-workers have carried out a comprehensive study about genomic organization of β-tubulin genes in several Leishmania species; these authors suggest that the gene organization has evolved to satisfy a need for innovative expression for β-tubulin genes [9]. In this work, we studied the organization of α-tubulin genes in Leishmania braziliensis based on the available, yet incomplete, genome sequence. A comparison with the organization of this gene in L. infantum and L. major is also provided. The 5 and 3 untranslated regions (UTRs) for the different α-tubulin genes in L. braziliensis have been determined as well as their mrna expression levels under different conditions. Results and discussion Genomic organization of α-tubulin genes in L. braziliensis, L. infantum and L. major In the genome of Leishmania major (MHOM/IL/81/ Friedlin), the first Leishmania genome that was sequenced [13], a sole α-tubulin locus exists. According to the data available at the GeneDB database [14], the locus is located at chromosome 13 and contains twelve copies (LmjF to LmjF ) having identical ORFs both in sequence and length (1356 bp), arranged in a head-to-tail tandem organization (Figure 1A). A similar arrangement, containing two copies (LmxM and LmxM ) separated by a sequence gap, and located also at chromosome 13, was found in the GeneDB database for Leishmania mexicana (MHOM/GT/2001/ U1103) genome. In contrast, according to the genome database (GeneDB), the Leishmania infantum (MCAN/ ES/98/LLM-877) genome contains two α-tubulin loci, both located at chromosome 13 and separated by a region of kb. The more 5 locus (Figure 1A) contains only a gene copy (LinJ , ORF: 1356 bp), whereas the other locus (Figure 1B) has a complete copy (LinJ , ORF: 1356 bp) and a truncated one (LinJ , ORF: 708 bp). The genome of Leishmania (Viannia) braziliensis (MHOM/BR/75/M2904) [13], causative agent of CL and MCL in the New World [15], also contains two loci, one located at chromosome 13 and the other at chromosome 29. The locus at chromosome 13 (Figure 1A) is composed by two complete copies (LbrM and LbrM , ORFs: 1356 bp) and an α-tubulin-like gene (LbrM , ORF: 702 bp). The locus at chromosome 29 (Figure 1A) contains a sole copy consisting of a truncated form of the α-tubulin gene (LbrM , ORF: 780 bp). Comparison of the genomic region around the α-tubulin loci in L. major, L. infantum and L. braziliensis revealed that the chromosomal regions surrounding the α-tubulin genes at chromosome 13 have experienced remarkable reorganizations in these three Leishmania species, and the α-tubulin locus itself appears as the target of DNA deletion and inversion events (Figure 1A). Thus, between L. major and L. infantum an inversion including the LmjF gene (colored in yellow in Figure 1A), the α-tubulin locus (LmjF tolmjf , colored in red in Figure 1A) and the LmjF to LmjF genes (colored in

82 Ramírez et al. BMC Genomics 2013, 14:454 Page 3 of 12 A B Figure 1 Genomic organization of α-tubulin genes and surrounding regions in three Leishmania species. Panel A: comparison among L. braziliensis (LbrM) α-tubulin loci and syntenic regions in L. infantum (LinJ) and L. major (LmjF) genomes. Panel B: comparison among the specific L. infantum α-tubulin locus and the syntenic regions of L. braziliensis and L. major, species in which this locus is absent. Red boxes represent the α-tubulin genes. L. major α-tubulin locus contains 12 genes (dashed rectangle). Each block of syntenic genes in the different Leishmania species, and reorganization events affecting them, is colored differently. The diagonal arrow, point to the LinJ that has an inverted orientation regarding the homologous gene in L. major (B). Blue vertical bars denote gaps in sequence. Numbers in bold at the start and end of each gene cluster are the last four digits of GeneDB gene entries. green in Figure 1A) took place. As a result of this event, the ORF polarity of the LinJ to LinJ , α-tubulin (LinJ ) and LinJ genes was changed with respect to the equivalent genes of L. major. In L. braziliensis, regarding the L. major chromosomal organization, a region spanning from the LmjF.0200 to the LmjF.0270 gene, corresponding to a string of 8 genes encoding for 7 hypothetical proteins and one putative class 3 lipase (colored in yellow in Figure 1A), was deleted. These deleted genes are present at chromosome 29 (LbrM to LbrM , colored in yellow in Figure 1A) in the L. braziliensis genome; this reorganization that seems the result of two transposition events dragged a region of the α-tubulin locus, generating the LbrM gene (colored in red in Figure 1A), which contains a truncated sequence of the prototypical α- tubulin gene (see below). The other α-tubulin locus at L. infantum chromosome 13, comprising as mentioned above a partial and a complete copy of α-tubulin coding sequence (Figure 1B), is found in a region that also has experienced clear reorganizations in these three Leishmania species. Thus, the regions flanking the α-tubulin genes LinJ and LinJ in L. infantum chromosome have experienced a substantial reorganization regarding the equivalent chromosomal region in L. major, and again the α- tubulin locus (absent in L. major) appeared as the center of the reorganization events (Figure 1B). Another minor transposition event, regarding the LinJ gene (signaled by a diagonal arrow in Figure 1B) took place after separation of these two Leishmania species. This chromosomal region in L. braziliensis (Figure 1B) is very similar to the L. major homologous region (α-tubulin genes are also absent), excepting an insertion comprising the LbrM to LbrM gene block (Figure 1B). The LbrM LbrM orthologous are located on chromosome 34 in both L. major and L. infantum (data not shown). In summary, these analyses pointed out that the α- tubulin gene loci have been reorganized in a drastic manner along Leishmania speciation. However, this fact contrasts with the chromosomal organization of the three β-tubulin loci that is largely syntenic in L. major, L. infantum and L. braziliensis [9]. Nevertheless, it cannot be excluded the possibility that differences in the chromosomal distribution and organization of α-tubulin genes among L. major, L. infantum and L. braziliensis are the result of artifacts generated during assembling of contigs into chromosomal scaffolds. The L. infantum and L. braziliensis genome sequences were produced by whole-genome shotgun sequencing to five- and six-fold coverage, respectively [12]. The resulting assemblies of L. infantum and L. braziliensis yielded 470 and 1,031 contigs, respectively. Finally, chromosomal scaffolds were produced by aligning contigs against the reference L. major sequence [13]. However, sequence gaps remain to be determined in the genome sequences for both L. infantum and L. braziliensis (according to the GeneDB database). Remarkably, the α-tubulin locus at chromosome 29 in L.

83 Ramírez et al. BMC Genomics 2013, 14:454 Page 4 of 12 braziliensis (Figure 1A) and one of the α-tubulin loci at chromosome 13 of L. infantum (Figure 1B) are located at the end of contigs (next to sequence gaps). Copy number determination in the L. braziliensis α-tubulin loci As shown in Figure 1, the genomic regions containing the two α-tubulin loci in chromosomes 13 and 29 of L. braziliensis has not been sequenced in full; there are sequence gaps that do not permit deducing the number of genes present at each locus. Moreover, tandem gene arrays are among the most challenging to resolve correctly using current genome sequencing technologies, since repetitive sequence reads tend to collapse into a single contig when no variation exists to distinguish them. Previous studies in L. major [16] and L. enriettii [10] showed the existence of tandem arrangements of α-tubulin genes; in fact, the L. major genome database includes twelve gene copies tandemly arranged at chromosome 13. In order to determine the number of genes and their organization in the two α-tubulin loci of L. braziliensis, Southern blots containing DNA digested with selected restriction enzymes were hybridized with a probe derived from the α-tubulin coding region (Figure 2). Southern blot analysis of genomic DNA, partially digested with the Csp451 restriction enzyme, evidenced the typical ladder of tandemly repeated genes (Figure 2A). At least 8 copies of the repeated unit (2.08 kb in length) were observed. According to the restriction maps of the two α-tubulin loci (Figure 2B, 2C and 2D), this tandem should be present in the locus at chromosome 13, whereas the locus at chromosome 29 would contain a sole α-tubulin gene (see the hybridization band pointed by the triangle in Figure 2A, and 2B). Recently, Rogers et al. [11], analyzing Illumina highthroughput sequencing data, inferred that L. braziliensis genome should contain 15 α-tubulin copies (haploid content). Tandemly repetition of genes has been proposed as a direct mechanism for increasing the transcript abundance of highly expressed proteins [8], and it is known that α-tubulin is an abundant protein in Leishmania [2]. When L. braziliensis total DNA was digested with restriction enzymes lacking cut sites within the α-tubulin loci (PstI and ApoI), and the hybridization pattern was analyzed by Southern blotting, a conspicuous result was obtained (Figure 2B). The presence of three (PstI) and two (ApoI) large bands was unexpected. An explanation to this finding may be either the existence of allelic sequence polymorphisms in the regions surrounding the α-tubulin locus at chromosome 13 or different copy numbers of α-tubulin genes in each homologous chromosome. Indeed, similar observations have been described for L. braziliensis and other trypanosomatids regarding HSP70, KMP-11 and histone H2A gene loci [17-19]. Moreover, the presence of three hybridization bands in the lane containing PstI digested-dna would be indicating that L. braziliensis has three homologous for chromosome 13, a very plausible possibility taking into account recent studies showing that L. braziliensis genome is essentially triploid [11]. Sequence analysis of the α-tubulins in L. braziliensis The genomic analysis described above indicated that the L. braziliensis α-tubulin genes are encoding for three different amino acids polypeptides: the prototypical α-tubulin (encoded by genes LbrM and LbrM ) and two α-tubulin variants, dubbed α-tubulin-a (LbrM ) and α-tubulin-b (LbrM ) (Figure 3). The prototypical α-tubulin is a 451 amino acid protein with a molecular weight of 49.7 kda and an isoelectric point of 4.9. In contrast, the α-tubulin-a is a shorter sequence with 233 amino acids, molecular weight of 24.9 kda and isoelectric point of 6.9. Similarly, the α-tubulin-b sequence contains 259 amino acids, has a molecular weight of 28.8 kda and an isoelectric point of 5.0. As showninfigure3,theα-tubulin-a is identical to the α-tubulin in the 81 N-terminal amino acids, but they are absolutely divergent in the rest of the sequence. An intriguing finding was the observation of a remarkable sequence identity (100%) between the divergent region of gene LbrM and a genomic region of chromosome 28, located at the intercoding region of genes LbrM and LbrM (see Additional file 1). In contrast, α-tubulin-b sequence, excluding the 58 N- terminal amino acids, was found to be identical to the C-terminal half of the prototypical α-tubulin. Also, this α-tubulin protein variant may have an extended sequence at the N-terminal region, since the LbrM annotated gene is close to a gap in the genomic sequence of the L. braziliensis genome database (Figure 1A). As mentioned above, if assembly artifacts exist in the L. braziliensis genome database, the real existence of the α-tubulin variants encoded by genes LbrM and LbrM may be questioned. To elucidate this, we have searched in the literature for experimental evidence of these genes or their products. The sole reference found is their presence in the gene lists generated by Rogers and co-workers [11] when analyzed the copy number of genes along the genome of L. braziliensis. However, this is not a demonstration of the real existence of these genes as the copy number was determined by mapping Illumina reads to the reference genome [12], but it was not analyzed whether the reads map homogenously along the gene ORF. On the other hand, none of these genes have homologs in the L. braziliensis

84 Ramírez et al. BMC Genomics 2013, 14:454 Page 5 of 12 Figure 2 Genomic organization of L. braziliensis α-tubulin genes. Southern blot of promastigote DNA hybridized with the α-tubulin ORF. (A) Two μg of L. braziliensis DNA were partially digested with Csp451 for 2 min (lane 2); 5 min (lane 3) and 15 min (lane 4); lane 5 contains 1 μg of totally digested DNA. Thin arrows in panel A point to the ladder bands; a thick arrow (in panels A and B) points to the repeated unit; the arrow head and the asterisk (in panels A and B) mark additional hybridization bands. (B) Southern blot corresponding to 3 μg o f L. braziliensis DNA digested with either PstI (lane 2) or ApoI (lane 3); 5 min of film exposure. Lane 4 shows a Southern blot of 3 μg of Csp451-digested DNA; 20 min of film exposure. Thin arrows point to hybridization bands. Molecular weight markers: lanes 1, a mixture of undigested and HindIII-digested DNA from λ phage; lanes 6, 1-Kb plus marker (Invitrogen California, USA). The position of the DNA markers in the blot was revealed by including digoxigenin-labeled markers in the hybridization mixture. As probe, the L. braziliensis α-tubulin ORF was used. (C) Hypothetical map for the α- tubulin locus in L. braziliensis chromosome 13, as deduced from Southern blot analyses and genomic sequence at GeneDB database (D). Map for α-tubulin locus in L. braziliensis chromosome 29, as deduced from genomic sequence at GeneDB database. Pentagonal shaped boxes represent α-tubulin genes, numbers inside each box are GeneDB entries (LbrM , LbrM , LbrM and LbrM ); filled boxes at the end of each gene represent the 3 UTR; and rectangles located at the 5 end of each gene, the 5 UTR. Figure 3 Comparison of α-tubulin sequences among Leishmania species. Multiple sequence alignment of LbrM (Lbr0190), LbrM (Lbr0200), LinJ (Lin0330), LmjF (Lbr0280), LbrM (Lbr2700), LinJ (Lin1450) and LbrM (Lbr0210) deduced amino acid sequences, constructed using Clustal-W and Jalview tools.

85 Ramírez et al. BMC Genomics 2013, 14:454 Page 6 of 12 MHOM/BR/75/M2903 strain [20], in other Leishmania species, even though several genomes have been sequenced (L. panamensis, L. major, L. infantum, L. mexicana, L. donovani and L. tarentolae), or in related trypanosomatids (Trypanosoma brucei and T. cruzi). Finally, an additional finding pointing to a possible assembly error in gene LbrM is the fact that the region conserved with α-tubulin would extend further (35 amino acids) if the nucleotide at position 245 is deleted (data not shown). The L. braziliensis α-tubulin locus at chromosome 13 contains two types of α-tubulin genes differing in their 3 UTR Given that Leishmania genes are transcribed into polycistronic RNA precursors that need to be further processed into individual mrnas by trans-splicing and polyadenylation, post-transcriptional regulation represents the main level of controlling gene expression in these parasites [8,21]. Consequently, regulatory sequences located in the 5 and 3 untranslated region (UTR) are involved in the modulation of mrna processing, mrna stabilization/destabilization, mrna halflife, or translation efficiency [8,21]. To determine the UTRs for L. braziliensis α-tubulin gene, RT-PCR reactions using specific oligonucleotides were performed. Thus, it was possible to determine the 5 UTR region of the α-tubulin genes LbrM and LbrM , which was 69 nucleotides in length and identical for both genes. This sequence was deposited in the GenBank database under the accession number FJ750454, and it was incorporated to the GeneDB database [22]. Regarding the 3 UTR, by RT-PCR we determined that this region for LbrM (and probably for other genes present in the locus, see below) is 369-nucleotide in length (GenBank accession number FJ750455); henceforth this sequence will be referred as 3 UTR-I. On the other hand, the 3 UTR of the last gene of the cluster (i.e. LbrM ), referred here as 3 UTR-II, was found to be highly divergent (Figure 4A). Taking into account that the L. braziliensis α-tubulin locus at chromosome 13 should be composed by 8 15 copies of the prototypic α-tubulin gene, but they collapsed to only two (LbrM and LbrM ) during assembly process, it is reasonable concluding that the 3 UTR for the rest of genes would be identical or near-identical to the 3 UTR-I. Similar situation has been reported in β tubulin array from L. major [9], and HSP70 genes [17] in which the last gene of the tandem bears a 3 UTR different to that found in the rest of genes. The distinctive genomic environment provided by each 3 UTR type (I and II) might obey to a need of providing specific expression profiles that ensure the availability of the α-tubulin protein under different conditions as occurs with the HSP70 protein [23]. Remarkably, bioinformatics analysis of these two sequences showed that whereas the 3 UTR-I (LbrM gene) has a PRE motif (Figure 4B), which has been implicated in the promastigote-specific expression of several genes [24], the 3 UTR-II (LbrM gene) has an ARE motif (Figure 4C), which is recognized as an mrna instability element [25]. The mrna levels for L. braziliensis α-tubulin are controlled post-transcriptionally by mechanisms sensitive to changes in environmental temperature Analysis of α-tubulin gene expression in L. braziliensis has not been addressed to date. Early studies in Leishmania enriettii demonstrated that in agreement with the greater tubulin content in the promastigote stage, the levels of α- and β-tubulin mrnas in the promastigotes were significantly higher than those found in amastigotes [26]. In L. major, using microarray hybridizations, it was found that α-tubulin mrnas are 6.3-fold more abundant in promastigotes than in amastigotes [27]. However, in L. mexicana, similar amounts of tubulin mrnas were found in both promastigotes and amastigotes [28,29]. In the related trypanosomatid T. cruzi, the regulation of tubulin genes has been studied in some extent [30,31]. In this parasite, lower levels of the α- and β- tubulin transcripts are found in amastigotes and trypomastigotes compared to epimastigotes. Experimental evidence suggests tubulin mrna half-lives are negatively affected by the amount of free, unpolimerized tubulin proteins. The regulatory mechanism would operate through the recognition of sequence elements located at the beginning of the coding region and in the 3 UTR of the tubulin genes [31]. Temperature shifts trigger differential gene expression and stage transformation in Leishmania [32]. Thus, we first examined the effect of heat shock treatment on the L. braziliensis α-tubulin mrna stability. For this purpose, parasites were cultured at 35 C during several periods of time, determining the parasite morphology and α-tubulin mrna abundance at each time culture-point. As shown in Figure 5, as incubation time at 35 C was increased, clear alterations in the parasite morphology were observed; parasites turned into rounded shape forms. Interestingly, a concomitant decrease in the α- tubulin mrna abundance was also observed, suggesting a down-regulation of α-tubulin mrnas levels during adaptation of the parasite to the mammalian host temperature. In order to obtain clues about the regulatory mechanisms regulating mrna stability of the L. braziliensis α-tubulin genes, we used inhibitors of transcription

86 Ramírez et al. BMC Genomics 2013, 14:454 Page 7 of 12 Figure 4 Analysis of the 3 UTR of α-tubulin genes from Leishmania braziliensis. (A) Alignment between the 3 UTR-I (LbrM ) and the 3 UTR-II (LbrM ). (B) PRE element (highlighted in blue in A) identified in the 3 UTR-I. (C) ARE element (highlighted in red in A) observed in the 3 UTR-II. The color scale in B and C denotes the structure probability from blue (0) to red (1), according to [44].

87 Ramírez et al. BMC Genomics 2013, 14:454 Page 8 of 12 Figure 5 Leishmania braziliensis morphology and α-tubulin RNA accumulation after heat shock treatment. Promastigotes cultures were incubated at 26 (A) or 35 C with 5% CO 2 during 30 min (B), 1 hour (C), 2 hours (D) and 4 hours (E). Total RNA was extracted from each time point, and RNA aliquots of 8 μg each were analyzed by Northern blotting (F). The blots were hybridized with the α-tubulin ORF probe and ethidium bromide rrna staining was used as normalizing signal. (actinomycin D), trans-splicing (sinefungin) and protein synthesis (cycloheximide). The effects of these drugs were analyzed at both 26 C and 35 C for several periods of time (Figure 6). As expected, inhibition of transcription and mrna processing at 26 C, led to a continuous decrease in the α-tubulin mrnas (Figure 6, panel A). The decrease was more dramatic in parasites incubated at 35 C (Figure 6, panel C), suggesting the existence of a destabilizing mechanism o- perating at this temperature. A support for the existence of such a specific mechanism came from the observation that protein synthesis inhibition of L. braziliensis promastigotes at 35 C (Figure 6, panel D) but not at 26 C (Figure 6, panel B), led to an increase of the α- tubulin mrna half-lives. Moreover, protein synthesis inhibition at 26 C (Figure 6, panel B) seems to have no effect on the decay rate of the α-tubulin mrnas (Figure 6, panel A). Thus, it can be hypothesized the existence of a labile protein factor, induced during promastigote to amastigote differentiation, that is responsible of decreasing the α-tubulin mrna half-lives in the mammalian stage of L. braziliensis. This finding would be in agreement with the fact, known since the 1980 decade, that tubulins are more abundant proteins in the promastigote stage than in the amastigote one [5,28,29]. Gene expression in trypanosomatids is controlled by post-transcriptional mechanisms relying on the modulation of mrna processing, mrna stabilization/destabilization, mrna half-life, translation efficiency or post-translational modifications [8,21]. Accordingly, a variety of elements in the untranslated regions (UTR) have been shown to regulate these events [33-35]. Now, in this study, the genomic organization and the structure of 5 and 3 UTRs for α-tubulin genes have been determined. Next step will be to investigate the involvement of the motifs contained in the 3 UTR-I and -II sequences in the regulatory mechanisms controlling tubulin expression in L. braziliensis. Conclusions The analysis of the genomic organization and genome distribution of α-tubulin genes in several Leishmania species suggests that these genes have been reorganized in a drastic manner along Leishmania speciation. Nevertheless, the existence of a gene cluster, consisting of several copies of tandemly arranged α-tubulin genes, was found to be a common feature in the different Leishmania species. In the L. braziliensis tandem array, two types of α-tubulin genes differing only in their 3 UTR were characterized: most of the α-tubulin gene copies have an identical 3 UTR (named 3 UTR-I), whereas

88 Ramírez et al. BMC Genomics 2013, 14:454 Page 9 of 12 Figure 6 Heat shock treatment and protein synthesis inhibition effect on the stability of α-tubulin transcripts. For total transcription inhibition, promastigotes cultured at 26 C were incubated with 10 μg/ml sinefungin (Sinef) five minutes previously to the addition of 10 μg/ml actinomycin D (Act D). Afterwards, cultures were incubated either at 26 C (A) or 35 C with 5% CO 2 (C) for 0, 0.5, 1, 2, and 4 hours. For protein synthesis inhibition, 20 μg/ml of cycloheximide (CHX) was used in promastigotes cultured either at 26 C (B) or 35 C with 5% CO 2 (D) for 0, 0.5, 1, 2, and 4 hours. Finally, total RNA was extracted, and 8 μg from each sample were analyzed by Northern blotting. The blots were hybridized with α-tubulin ORF probe. Before transferring, gels were stained with ethidium bromide and photographed; rrna staining was used as normalizing signal for densitometric measurement. For each series, densitrometric graphs (bottom panels) were standardized against the RNA signal found at time 0 (26 C), which was arbitrarily set as 1.0. the last copy of the tandem possesses a different sequence (named 3 UTR-II). Finally, we demonstrated that mrna expression of L. braziliensis α-tubulin genes is controlled by a temperature-dependent posttranscriptional mechanism. Methods Parasite cultures and nucleic acids extraction Promastigotes of L. braziliensis MHOM/BR/75/M2904 were cultured in vitro either at 26 C in Schneider s insect medium (Sigma Aldrich, Inc., St. Louis, USA) supplemented with 20% heat-inactivated fetal calf serum (Eurobio, Inc., Les Ulis, France), and 0.1 μg/ml of 6-biopterin (Sigma Aldrich,Inc., St. Louis, USA) or at 35 C with 5% CO 2 by several time periods. Total DNA and RNA from parasite cells were isolated using the phenolchloroform-isoamilic alcohol method [17], and the TRIzol method (Invitrogen, California, USA) according to manufacturer instructions, respectively. Oligonucleotides All oligonucleotides were synthesized by IDT, Inc. (Miami, USA). The L. braziliensis α-tubulin coding region was amplified from genomic DNA by PCR with Lb-Tub-F (5 GGATCCATGCGTGAGGCTATCTGC 3 ) and Lb-Tub-R (5 CTGCAGCTAGTACTCCTC GACGTCCT 3 ) primers, which contain the BamHI and PstI restriction sites (underlined in the sequence), respectively. Amplification of the UTRs was performed from poly-t primed-cdna using the following primers: LbSL (5 CGCTATATAAGTATCAGTTTC 3 ) and LbαT-106 (5 GTGAGGCTATCTGCATTCA 3 ) for the 5 UTR and Lbαt1312 (5 TCGTGCACTGGTACGTTG 3 ) and poly-t EcoRI (5 CGGAATTCTTTTTTTTTT TTTTTTTTT 3 ), for the 3 UTR. Cloning sequences and in silico analyses First-strand cdna synthesis was carried out from L. braziliensis total RNA using an oligo-dt primer and the Transcriptor first strand cdna synthesis kit (Roche, Inc., Mannheim, Germany). The following PCR mix reaction was used for all amplifications in a final volume of 20 μl: 1 reaction buffer (10 mm Tris-HCl ph 9.0, 50 mm KCl, 0.1% Triton X-100), 1.5 mm MgCl 2, 0.4 mm of dntp mix, 0.5 μm of each primer, 1 M betain, 0.06 units per μl of expand high fidelity enzyme (Roche, Inc., Mannheim, Germany) and 15 ng/μl DNA or 1 μl ofcdna product. An MJ Research PTC-100 DNA thermocycler was used for the reaction with the following amplification profile: 95 C/5 min (initial denaturation), 35 cycles at

89 Ramírez et al. BMC Genomics 2013, 14:454 Page 10 of C/0.5 min, annealing at C/0.5 min and extension for 72 C/1 min, with a final incubation at 72 C for 10 min. All the amplified fragments were resolved in agarose gels and visualized under UV exposure after ethidium bromide staining. RT-PCR products were excised from gels, purified using Wizard SV Gel and PCR Clean-Up System (Promega, Inc., Madison, WI, USA) and cloned into the pcr II (Invitrogen, California, USA) or pgem -T Easy plasmids (Promega, Inc., Madison, WI, USA). The following clones were obtained and submitted to the Addgene web site [36] ptolbαtub-b (Addgene ID, 42937), containing the α-tubulin ORF, plb5αtub-d (Addgene ID, 42938), the 5 UTR and plb3αtub-c6 (Addgene ID, 42939), the 3 UTR. The sequences from each plasmid insert were determined using the Big Dye Terminators v3.1 kit (Applied Biosystem, California, USA) by automatic sequencing at the Servicio de Genómica (Parque Científico de Madrid, Universidad Autónoma de Madrid). In order to deduce the α-tubulin mrna UTRs from other Leishmania species, LALIGN [37], and ClustalW analyses [38] were carried out. Gene comparison for investigating the constitution of α-tubulin variants was performed by BLAST/N analysis [20]. Data from TriTrypDB [39] were retrieved for studying the α- tubulin loci synteny and comparison among the three Leishmania species was carried out by BLAST/N analysis. Southern blot analyses With the aim of choosing endonucleases cutting at the boundaries of the α-tubulin locus (PstI and ApoI) or inside it (Csp451), sequences of α-tubulin loci from the three Leishmania species were retrieved from GeneDB database [40] and used in an in silico restriction analysis through NEBcutter V2.0 tools [41]. DNA from promastigotes was totally or partially digested with the selected restriction enzymes according to the manufacturer specifications (Promega, Inc., Madison, WI, USA). Resulting fragments were electrophoresed during sixteen to eighteen hours at 50 volts on 25 cm low electroendosmosis agarose gel at 0.8% (Ambion, Inc., Texas, USA), transferred to a nylon membrane (Roche, Inc., Mannheim Germany) by the saline-sodium citrate (SSC) buffer method [42] and hybridized with the α- tubulin ORF as probe. For probe synthesis, the L. braziliensis α-tubulin gene was released from clone ptolb α tub-b by BamHI/PstI cutting,excisedfrom gel, purified using Wizard SV Gel and PCR Clean-Up System (Promega, Inc., Madison, WI, USA), and finally labeled with digoxigenin by randomly primed synthesis using the DIG High Prime DNA Labeling kit (Roche, Inc., Mannheim, Germany). Hybridizations were performed using the Detection Starter kit II (Roche, Inc., Mannheim, Germany) according to manufacturer's instructions. Afterwards, membranes were washed twice under the following conditions: 2 sodium citrate solution (SSC) and 0.5% (p/v) sodium dodecyl sulfate (SDS) at room temperature for 5 min, 0.5 SSC, 0.1% SDS solution for 15 min at 65 C and 0.1 SSC, 0.1% SDS solution for 15 min at 65 C, under constant shaking. Finally, after the immunological detection according to the above mentioned kit recommendations, membranes were exposed on Curix RP2 plus medical X-Ray film (AGFA, Mortsel, Belgium). Northern blot analyses To investigate the α-tubulin expression levels, L. braziliensis promastigote cultures were treated as follows: maturation of mrna were inhibited by addition of 10 μg/ml sinefungin to the L. braziliensis promastigote cultures at logarithmic phase ( promastigotes per ml), synthesis of RNA were inhibited by addition of 10 μg/ml actinomycin D five min later [43]. Protein synthesis inhibition was achieved by adding 10 μg/ml of cycloheximide on promastigote cultures simultaneously treated with sinefungin and actinomycin D. Parasites were treated at 26 or 35 C with 5% CO 2, with or without inhibitors for several time periods (0.5, 1, 2 and 4 hours). Afterwards, parasites were harvested for RNA extraction and 8 μg of total RNA per line were separated on 1.5% (w/v) low electroendosmosis agarose/mops/ formaldehyde gels (Ambion, Inc., Texas, USA) and transferred to nylon membranes (Roche, Inc., Mannheim, Germany). Probes, hybridization and immunological detection were performed as previously mentioned. Additional file Additional file 1: Figure S1. (A) The 3 end of LbrM gene is derived from chromosome 28. In the intercoding region of LbrM and LbrM entries at chromosome 28 from L. braziliensis there is a 457 nucleotide sequence that is identical to the final 355 nucleotides of the LbrM ORF and the first 102 downstream nucleotides. Boxes in red comprise ORFs. (B) Alignment of the LbrM entry with the intergenic region between the LbrM and the LbrM entries (28IGR). A 100% of identity in 457 nt overlapped, showed in red, was found. The ATG and stop codons of the LbrM entry are indicated in blue. Competing interests The authors declare that they have no competing interests. Authors contributions CAR, JMR, and CJP conceived and designed the experiments. CAR performed the experiments. CAR, JMR, and CJP analyzed the data. CAR, JMR, and CJP wrote the paper. All authors revised and approved the final version of the manuscript. Acknowledgments CJP s lab was supported by Pontificia Universidad Javeriana (Colombia), Research project ID PPTA JMR s lab was supported by grants from the Ministerio de Ciencia y Tecnología (BFU ) and the Fondo de Investigaciones Sanitarias (ISCIII-RETIC RD12/0018/0009-FEDER). CAR was

90 Ramírez et al. BMC Genomics 2013, 14:454 Page 11 of 12 supported by Colciencias, Programa Nacional de Doctorados, convocatoria Author details 1 Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Carrera 7 No , Edificio 52, Oficina 608, Bogotá, Colombia. 2 Centro de Biología Molecular Severo Ochoa (CSIC-UAM), Universidad Autónoma de Madrid, 28049, Madrid, Spain. Received: 8 February 2013 Accepted: 19 June 2013 Published: 6 July 2013 References 1. McKean PG, Vaughan S, Gull K: The extended tubulin superfamily. J Cell Sci 2001, 114(Pt 15): Gull K: The cytoskeleton of trypanosomatid parasites. Annu Rev Microbiol 1999, 53: Murray HW, Berman JD, Davies CR, Saravia NG: Advances in leishmaniasis. Lancet 2005, 366(9496): Alvar J, Velez ID, Bern C, Herrero M, Desjeux P, Cano J, Jannin J, den Boer M: Leishmaniasis worldwide and global estimates of its incidence. PLoS One 2012, 7(5):e Fong D, Chang KP: Tubulin biosynthesis in the developmental cycle of a parasitic protozoan, Leishmania mexicana: changes during differentiation of motile and nonmotile stages. Proc Natl Acad Sci U S A 1981, 78(12): Coulson RM, Connor V, Chen JC, Ajioka JW: Differential expression of Leishmania major beta-tubulin genes during the acquisition of promastigote infectivity. Mol Biochem Parasitol 1996, 82(2): Jackson AP, Vaughan S, Gull K: Evolution of tubulin gene arrays in trypanosomatid parasites: genomic restructuring in Leishmania. BMC Genomics 2006, 7: Requena JM: Lights and shadows on gene organization and regulation of gene expression in Leishmania. Front Biosci 2011, 16: Jackson AP, Vaughan S, Gull K: Comparative genomics and concerted evolution of beta-tubulin paralogs in Leishmania spp. BMC Genomics 2006, 7: Landfear SM, McMahon-Pratt D, Wirth DF: Tandem arrangement of tubulin genes in the protozoan parasite Leishmania enriettii. Mol Cell Biol 1983, 3(6): Rogers MB, Hilley JD, Dickens NJ, Wilkes J, Bates PA, Depledge DP, Harris D, Her Y, Herzyk P, Imamura H, Otto TD, Sanders M, Seeger K, DujardinJC,BerrimanM,SmithDF,Hertz-FowlerC,MottramJC: Chromosome and gene copy number variation allow major structural change between species and strains of Leishmania. Genome Res 2011, 21(12): Peacock CS, Seeger K, Harris D, Murphy L, Ruiz JC, Quail MA, Peters N, Adlem E, Tivey A, Aslett M, Kerhornou A, Ivens A, Fraser A, Rajandream MA, Carver T, Norbertczak H, Chillingworth T, Hance Z, Jagels K, Moule S, Ormond D, Rutter S, Squares R, Whitehead S, Rabbinowitsch E, Arrowsmith C, White B, Thurston S, Bringaud F, Baldauf SL, et al: Comparative genomic analysis of three Leishmania species that cause diverse human disease. Nat Genet 2007, 39(7): Ivens AC, Peacock CS, Worthey EA, Murphy L, Aggarwal G, Berriman M, Sisk E, Rajandream MA, Adlem E, Aert R, Anupama A, Apostolou Z, Attipoe P, Bason N, Bauser C, Beck A, Beverley SM, Bianchettin G, Borzym K, Bothe G, Bruschi CV, Collins M, Cadag E, Ciarloni L, Clayton C, Coulson RM, Cronin A, Cruz AK, Davies RM, De Gaudenzi J, et al: The genome of the kinetoplastid parasite, Leishmania major. Science 2005, 309(5733): Logan-Klumpler FJ, De Silva N, Boehme U, Rogers MB, Velarde G, McQuillan JA, Carver T, Aslett M, Olsen C, Subramanian S, Phan I, Farris C, Mitra S, Ramasamy G, Wang H, Tivey A, Jackson A, Houston R, Parkhill J, Holden M, Harb OS, Brunk BP, Myler PJ, Roos D, Carrington M, Smith DF, Hertz-Fowler C, Berriman M: GeneDB-an annotation database for pathogens. Nucleic Acids Res 2012, 40(Database issue):d98 D Oddone R, Schweynoch C, Schonian G, de Sousa CS, Cupolillo E, Espinosa D, Arevalo J, Noyes H, Mauricio I, Kuhls K: Development of a multilocus microsatellite typing approach for discriminating strains of Leishmania (Viannia) species. J Clin Microbiol 2009, 47(9): Spithill TW, Samaras N: Genomic organization, chromosomal location and transcription of dispersed and repeated tubulin genes in Leishmania major. Mol Biochem Parasitol 1987, 24(1): Ramirez CA, Requena JM, Puerta CJ: Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization. Parasit Vectors 2011, 4: Diez H, Thomas MC, Uruena CP, Santander SP, Cuervo CL, Lopez MC, Puerta CJ: Molecular characterization of the kinetoplastid membrane protein-11 genes from the parasite Trypanosoma rangeli. Parasitology 2005, 130(Pt 6): Cuervo C, Lopez MC, Puerta C: The Trypanosoma rangeli histone H2A gene sequence serves as a differential marker for KP1 strains. Infect Genet Evol 2006, 6(5): BLAST/N analysis from TritrypDB. do;jsessionid=78874f49e41eb45cee66649d01fd46e5?questionfullname= UniversalQuestions.UnifiedBlast. 21. Clayton C, Shapira M: Post-transcriptional regulation of gene expression in trypanosomes and leishmanias. Mol Biochem Parasitol 2007, 156(2): Incorporation of the 5 UTR region from the α-tubulin genes LbrM and LbrM to the GeneDB database. LbrM ?actionName=%2FQuery%2FquickSearch&resultsSize=1&taxon NodeName=Root. 23. Folgueira C, Quijada L, Soto M, Abanades DR, Alonso C, Requena JM: The translational efficiencies of the two Leishmania infantum HSP70 mrnas, differing in their 3 -untranslated regions, are affected by shifts in the temperature of growth through different mechanisms. J Biol Chem 2005, 280(42): Holzer TR, Mishra KK, LeBowitz JH, Forney JD: Coordinate regulation of a family of promastigote-enriched mrnas by the 3 UTR PRE element in Leishmania mexicana. Mol Biochem Parasitol 2008, 157(1): Di Noia JM, D'Orso I, Sanchez DO, Frasch AC: AU-rich elements in the 3 - untranslated region of a new mucin-type gene family of Trypanosoma cruzi confers mrna instability and modulates translation efficiency. J Biol Chem 2000, 275(14): Landfear SM, Wirth DF: Control of tubulin gene expression in the parasitic protozoan Leishmania enriettii. Nature 1984, 309(5970): Leifso K, Cohen-Freue G, Dogra N, Murray A, McMaster WR: Genomic and proteomic expression analysis of Leishmania promastigote and amastigote life stages: the Leishmania genome is constitutively expressed. Mol Biochem Parasitol 2007, 152(1): Fong D, Wallach M, Keithly J, Melera PW, Chang KP: Differential expression of mrnas for alpha- and beta-tubulin during differentiation of the parasitic protozoan Leishmania mexicana. Proc Natl Acad Sci U S A 1984, 81(18): Fong D, Chang KP: Changes in tubulin mrnas during differentiation of a parasitic protozoan Leishmania mexicana. Ann N Y Acad Sci 1986, 466: Urményi TP, De Castro FT, Carvalho JF, De Souza W, Rondinelli E: Transcriptional and post-transcriptional control of tubulin gene expression in Trypanosoma cruzi. DNA Cell Biol 1992, 11(2): da Silva RA, Bartholomeu DC, Teixeira SM: Control mechanisms of tubulin gene expression in Trypanosoma cruzi. Int J Parasitol 2006, 36(1): Alcolea PJ, Alonso A, Gómez MJ, Moreno I, Domínguez M, Parro V, Larraga V: Transcriptomics throughout the life cycle of Leishmania infantum: high down-regulation rate in the amastigote stage. Int J Parasitol 2010, 40 (13): Matthews KR, Tschudi C, Ullu E: A common pyrimidine-rich motif governs trans-splicing and polyadenylation of tubulin polycistronic pre-mrna in trypanosomes. Genes Dev 1994, 8(4): Bartholomeu DC, Silva RA, Galvao LM, El-Sayed NM, Donelson JE, Teixeira SM: Trypanosoma cruzi: RNA structure and post-transcriptional control of tubulin gene expression. Exp Parasitol 2002, 102(3 4): Gupta SK, Carmi S, Waldman Ben-Asher H, Tkacz ID, Naboishchikov I, Michaeli S: Basal splicing factors regulate the stability of mature mrnas in trypanosomes. J Biol Chem 2013, 288(7): Addgene web site LALIGN a tool for aligning sequences. LALIGN_form.html. 38. ClustalW tool from EBI TritrypDB database GeneDB database.

91 Ramírez et al. BMC Genomics 2013, 14:454 Page 12 of NEBcutter V2.0 tool Sambrook J, Russel D: Southern hybridization. In Molecular Cloning: A Laboratory Manual.Volumen 1. 3rd edition. New York: Cold Spring Harbor Laboratory Press; 2001: Archer SK, Luu VD, de Queiroz RA, Brems S, Clayton C: Trypanosoma brucei PUF9 regulates mrnas for proteins involved in replicative processes over the cell cycle. PLoS Pathog 2009, 5(8):e RNAfold tool. doi: / Cite this article as: Ramírez et al.: Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression. BMC Genomics :454. Submit your next manuscript to BioMed Central and take full advantage of: Convenient online submission Thorough peer review No space constraints or color figure charges Immediate publication on acceptance Inclusion in PubMed, CAS, Scopus and Google Scholar Research which is freely available for redistribution Submit your manuscript at

92 MATERIALES, MÉTODOS Y RESULTADOS 7.3 Artículo No. 3 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis, comparación con otros tripanosomátidos 92

93 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis Disponible en línea en: , Vol. 16 N 1: SICI: (201101/04)16:1<29:SPDGDMDLBCCOT>2.0.TS;2-G Artículo original Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis, comparación con otros tripanosomátidos Paola Nocua 1, Cesar Ramírez 1, José María Requena 2, Concepción Judith Puerta 1* 1 Laboratorio de Parasitología Molecular, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá, Colombia. 2 Centro de Biología Molecular Severo Ochoa, Universidad Autónoma de Madrid (CSIC-UAM), Madrid, España. * cpuerta@javeriana.edu.co Recibido: ; Aceptado: Resumen Objetivo. Con el fin de aportar nueva información relevante para estudios de genotipificación y filogenética del género Leishmania, en este estudio se determinó y comparó la secuencia del maxicírculo de Leishmania braziliensis, cepa MHOM-BR-75-M2904, con las secuencias del maxicírculo reportadas para otras especies de tripanosomátidos. Materiales y métodos. La búsqueda de las secuencias del maxicírculo se realizó en las bases de datos de secuencias no ensambladas del GeneDB versión 2.1, así como en el GenBank, utilizando los genes ND8 y RPS12 de L. braziliensis como sonda inicial. Estas secuencias se ensamblaron y se compararon con sus homólogas en otros tripanosomátidos mediante el uso de herramientas bioinformáticas como LALIGN y ClustalW2. El tamaño total del maxicírculo se determinó mediante ensayos de Southern blot. Resultados. Se ensamblaron dos fragmentos del maxicírculo de L. braziliensis de 6535 y 4257 nucleótidos, cuyos genes presentaron elevada sintenia y similitud en sus secuencias con los previamente reportados en otras especies de Leishmania. Similitud que se extiende incluso a los patrones de edición de estas moléculas. Conclusiones. A pesar de ser L. braziliensis la especie más divergente del género Leishmania en cuanto a su genoma nuclear, el marxicírculo presenta una elevada conservación. Resultado que sugiere que el patrón de edición presente en las diferentes especies de Leishmania hasta ahora estudiadas se conserva también en el subgénero Viannia, lo que indica una elevada conservación en la edición de los transcritos mitocondriales a nivel de género. Palabras clave: ADN del cinetoplasto (ADNk), edición del ARN, Leishmania (Viannia) braziliensis, maxicírculo. Abstract Maxicircle genome partial sequence of Leishmania braziliensis: assembling and comparison with other trypanosomatids. Objective. With the aim to provide new insights for genotyping and phylogenetic studies of the Leishmania genus, in this study the sequence of the maxicircle in Leishmania braziliensis, strain MHOM-BR-75-M2904, was determined and compared with those reported in other trypanosomatids species. Materials and methods. Searches for maxicircle sequences were performed in the unassembled sequences of GeneDB database version 2.1, as well as in the GenBank, using the ND8 and RPS12 genes of L. braziliensis as the initial probes. These sequences were assembled and compared with the homologous sequences of trypanosomatids using the bioinformatics tools LALIGN and ClustalW2. The size of maxicircle was determined by Southern blot assays. Results. Two maxicircle fragments of 6535 and 4257 nucleotides were assembled. The sequences of these genes showed high synteny and similarity with the sequences in other Leishmania species. This similarity even was extended to the editing patterns of these molecules. Conclusions. Although L. braziliensis is the most divergent species of the Leishmania genus in their nuclear genome, the maxicicircle has a high conservation. This result suggests that the pattern of editing present in the different Leishmania species studied has been conserved also in the subgenus Viannia. These results indicate a high conservation in the editing of mitochondrial transcripts at the genus level. Key words: kinetoplast DNA (kdna), RNA editing, Leishmania (Viannia) braziliensis, maxicircle. 29

94 Universitas Scientiarum, 2011, Vol. 16 N 1: Resumo Seqüência do genoma parcial do maxicirculo de Leishmania braziliensis: montagem e comparação com outros tripanossomatídeos.objetivo. Com o fim de contribuir nova informação relevante para estudos de genotipagem e filogenética do género Leishmania, neste estudo determinou-se a sequência do maxicirculo de Leishmania braziliensis, cepa MHOM-BR-75-M2904, comparandosecom as seqüências do maxicirculo reportadas para outras espécies de tripanossomatídeos. Materiais e Métodos. A busca das seqüências do maxicirculo foi realizada nas bases de dados para seqüências não alinhadas no GeneDB versão 2.1, assim como no GeneBank, utilizando o genes ND8 e RPS12 de L. braziliensis como sonda inicial. Essas seqüências foram alinhadas e comparadas com as suas homologas em outros tripanossomatídeos, mediante o uso de ferramentas bioinformáticas como L-ALIGN e ClustalW2. O tamanho total do maxicirculo foi determinado mediante ensaios de Southern blot. Resultados. Foram alinhados dois fragmentos do maxicirculo de L. braziliensis de 6535 e 4257 nucleotídeos, cujos genes apresentaram elevada sintenia e similaridade nas suas seqüências com os genes previamente reportados nas outras espécies de Leishmania. A similaridade vista estende-se, inclusive, aos padrões de edição para estas moléculas. Conclusões. Apesar de L. braziliensis ser a espécie mais divergente do gênero Leishmania, no que se refere ao seu genoma nuclear, o maxicirculo apresenta uma alta conservação. Esse resultado sugere que o padrão de edição apresentado nas espécies de Leishmania até agora estudadas, é conservado também no subgênero Viannia, o que indica uma alta conservação na edição dos transcritos mitocôndriais ao nível de gênero. Palavras-chave: ADN de kinetoplasto (ADNk), edição de ARN, Leishmania (Viannia) braziliensis, maxicirculo. Introducción Las Leishmaniasis son un grupo de enfermedades producidas por parásitos protozoarios pertenecientes al género Leishmania, los cuales son transmitidos en América por la picadura de insectos del género Lutzomyia (1). Esta enfermedad tiene un amplio rango de manifestaciones las cuales abarcan desde la infección cutánea, mucocutánea a visceral (2). Dentro de los principales agentes etiológicos de la leishmaniasis cutánea y mucocutánea en Colombia se encuentra la especie Leishmania (Viannia) braziliensis (1). Las leishmanias, al igual que los otros géneros pertenecientes al orden Kinetoplastida, se caracterizan por la presencia de un organelo denominado cinetoplasto, correspondiente al ADN mitocondrial o ADNk del parásito (3). El cinetoplasto es una red compleja formada por dos clases de moléculas de ADN circular concatenadas entre sí: los minicírculos y los maxicírculos. Los primeros tienen un tamaño que varía entre 0,7 1.0 kb dependiendo de la especie de kinetoplástido, se encuentran repetidos entre veces por cinetoplasto, codifican para los ARN pequeños ricos en uridinas conocidos como ARN guías (ARNg) y se caracterizan por presentar una amplia variabilidad en sus secuencias (4-6). Los maxicírculos por su parte, con tamaños de kb y copias por cinetoplasto, son moléculas conservadas con excepción de la región divergente (DR), la cual se caracteriza por poseer elementos repetidos y tener una extensión variable, siendo de 4073 nt en Leishmania tarentolae (4, 7, 8). Los maxicírculos contienen dos ARN ribosomales (ARNr), algunos ARNg y codifican para18 genes estructurales incluyendo la proteína ribosomal S12 (RPS12), varias de las enzimas de la cadena respiratoria mitocondrial como la apocitocromo b (CyB), las subunidades I, II y III de la citocromo c oxidasa (COI, COII, COIII) y las subunidades 1, 3, 4, 7, 8 y 9 de la NADH deshidrogenasa (ND1, ND3, ND4, ND7, ND8 y ND9), aparte de cuatro marcos de lectura abiertos conocidos como MURF1, MURF2, MURF4 o ATPasa 6 (9) y MURF5 (4, 5, 10, 11). La información codificante de algunos de estos genes se encuentra encriptada, los transcritos generados con frecuencia carecen de codones que indiquen el inicio o fin de la traducción y la secuencia codificante está incompleta (12). Antes de ser traducidos, estos transcritos van a experimentar un proceso de edición, que, mediante la inserción y deleción de residuos de uridinas en sitios específicos del ARN naciente o pre-editado, conduce a la creación de marcos de lectura correctos (13). Este mecanismo de edición, que tiene una progresión en sentido 3 5, es asistido por los ARNg, los cuales actúan de molde o plantilla (14-16). Así, el ARNg en su zona de anclaje en su extremo 5 forma una dúplex de nt con el ARNm pre-editado. El número de uridinas adicionadas es guiado por la cantidad de adenosinas o guanosinas sin aparear con el ARN pre-editado presentes en el ARNg corriente abajo del dominio de anclaje. En tanto que los residuos de uridinas a delecionarse se marcan por su ausencia en el extremo 3 del fragmento que sobresale del dúplex ARNg:ARNm (16). Actualmente se conoce la totalidad del genoma del maxicírculo de algunas especies de kinetoplastidos como 30 Nocua et al

95 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis L. tarentolae (5, 10), Leishmania donovani (11), Trypanosoma brucei (5, 17-19) y Trypanosoma cruzi (20) y, secuencias parciales de los maxicírculos de Leishmania major (21), Leishmania amazonensis (22), Crithidia fasciculata (23, 24) y Phytomonas serpens (25, 26). En este artículo se reporta la secuencia de dos fragmentos no contiguos de la región codificante del genoma del maxicírculo de L. braziliensis, para un total de cobertura de 10,7 kb y, se presenta un análisis comparativo de estas secuencias con las de otros kinetoplástidos previamente reportadas. Materiales y métodos Parásitos La cepa de L. braziliensis MHOM-BR-75-M2904 utilizada en este estudio fue caracterizada y proporcionada por el Centro Internacional de Entrenamiento e Investigaciones Médicas (CIDEIM, Cali - Colombia). Los parásitos fueron crecidos a 26 ºC en medio Schneider (SIGMA, St. Louis, USA) suplementado con 20% (v/v) de suero fetal bovino inactivado (Eurobio, Les Ulis- Courtabeuf, Francia). Ensayos de Southern blot Para determinar el tamaño total del maxicírculo se realizó un ensayo de Southern blot utilizando ADN total del parásito, obtenido de acuerdo a Requena y colaboradores (1988), digerido con las enzimas de restricción BamHI, BstBI, EcoRI, HindIII, PvuI, PvuII, SphI y Xhol, de acuerdo a las indicaciones de la casa fabricante (Promega, Wisconsin, USA). Las enzimas se seleccionaron con base en la presencia de sitios únicos de restricción en el genoma del maxicírculo de L. tarentolae, L. donovani y L. major. Los fragmentos resultantes fueron resueltos mediante electroforesis horizontal, en un gel de agarosa al 0,8% y transferidos a membrana de nylon por el método de transferencia salina (28), para su posterior hibridación con un fragmento que contiene 155 pb correspondiente al extremo 5 no editado del gen ND8 de L. braziliensis (29, Material supl. 1), el cual no presenta identidad significativa con regiones del ADN nuclear del parásito. La sonda fue marcada con digoxigenina utilizando el estuche comercial DIG High Prime DNA Labeling and Detection Starter Kit II (Roche, Basel, Suiza). El protocolo de hibridación se realizó en condiciones de astringencia siguiendo las indicaciones del fabricante (Manual de Instrucción DIG High Prime DNA Labeling and Detection Starter Kit II). Posteriormente, se realizaron dos lavados en condiciones astringentes con solución salina citrato (SSC) 0,1% y SDS al 0,1% a 68 ºC por 15 min cada uno, seguidos de exposición a películas de rayos X Curix RP2 Plus (AGFA, Mortsel, Bélgica) durante 1h. Obtención de la secuencia parcial del maxicírculo de L. braziliensis La construcción de la secuencia parcial del maxicírculo de L. braziliensis se realizó mediante análisis BLAST de las secuencias reportadas en las bases de datos GeneDB de secuencias no ensambladas ( lbraziliensis/) y GenBank ( genbank). Como sonda inicial para los análisis de hibridación in silico del fragmento de 6535 pb se utilizó un fragmento de 155 pb correspondiente al extremo 5 no editado de la secuencia del gen ND8 del parásito (29, Material supl. 1), mientras que para el fragmento de 4257 se utilizó el gen RPS12 de L. braziliensis. La elongación de la secuencia en construcción se logró mediante pasos reiterativos de análisis BLAST/n de los extremos del fragmento ensamblado, seguido de análisis LALIGN con cada una de las entradas encontradas en el BLAST/n. Los números de acceso de las secuencias empleadas para el ensamblaje del maxicírculo se muestran en la tabla 1 (Material supl. 2A y 2B), con su correspondiente valor de e de significancia de los análisis BLAST. Análisis de las secuencias Las secuencias génicas de L. braziliensis se identificaron por similitud con las secuencias reportadas en L. tarentolae (N de acceso al GenBank M10126), cuyo maxicírculo ha sido secuenciado en su totalidad. Para ello, se compararon de forma individual cada una de las secuencias obtenidas con su contraparte en L. tarentolae, utilizando la herramienta LALIGN ( form.html). La comparación de varias secuencias se realizó mediante la herramienta ClustalW2 ( Tools/clustalw2/index.ht ml). Los perfiles de restricción in silico se determinaron utilizando la herramienta NEBcutter V2.0 ( La determinación de la sintenia se realizó mediante comparación del orden de los genes entre los distintos maxicírculos de las especies analizadas. La dirección de la transcripción de los genes se determinó de acuerdo a la presencia del marco de lectura abierto, luego del ensamblaje del genoma, en la cadena sentido o antisentido. La presencia putativa de dominios funcionales en la proteína putativa MURF5 se determinó mediante la herramienta InterproScan ( iprscan/). 31

96 Universitas Scientiarum, 2011, Vol. 16 N 1: Tabla 1. Descripción de las entradas utilizadas para la construcción de la secuencia del maxicírculo de L. braziliensis Fragmento N de acceso Tamaño (nt) e - value Base de datos AB e -25 GenBank Brazil75c12.q1k e -52 GeneDB Brazil63b03.p1k e -16 GeneDB Brazil1432f10.q1k e -67 GeneDB Brazil182d06.q1k e -21 GeneDB Brazil81e11.q1ka e -49 GeneDB Brazil227d04.p1k e -28 GeneDB Brazil555h03.p1k e -26 GeneDB Brazil1598g08.q1k e -90 GeneDB Brazil621f05.p1k e -21 GeneDB Brazil466g05.q1k e -13 GeneDB Brazil606f10.p1k e -13 GeneDB Brazil281b06.p1k e -13 GeneDB Brazil1348c08.q1k e -20 GeneDB Brazil1133b07.p1k e -64 GeneDB 6535 nts Brazil20h04.p1k RevComp e -111 GeneDB Brazil423g06.q1k e -30 GeneDB Brazil27a07.q1k e -160 GeneDB Brazil653a10.p1k RevComp e -27 GeneDB Brazil1081f06.p1k RevComp e -20 GeneDB Brazil251e11.p1k RevComp e -22 GeneDB Brazil81e11.p1ka RevComp e -29 GeneDB Brazil982e01.p1k e -21 GeneDB Brazil487c05.p1k RevComp e -30 GeneDB Brazil802h07.q1k RevComp e -34 GeneDB Brazil700a03.p1k RevComp e -23 GeneDB Brazil1252c02.q1k RevComp e -25 GeneDB Brazil595d07.p1k RevComp e -21 GeneDB Brazil1521b09.p1k RevComp e -15 GeneDB Brazil66e05.q1k RevComp e -45 GeneDB Brazil226a12.p1k RevComp e -38 GeneDB Brazil241b09.p1k RevComp e -33 GeneDB Brazil1501c09.q1k e -15 GeneDB Brazil1501c12.q1k e -08 GeneDB Brazil1001a09.p1k e -20 GeneDB Brazil1043b09.q1k e -07 GeneDB Brazil1043b09.p1k RevComp e -15 GeneDB Brazil827b08.p1k e -54 GeneDB 4257 nts Brazil484c11.q1k RevComp e -18 GeneDB Brazil483f03.p1k e- 05 GeneDB Brazil655c08.p1k e- 15 GeneDB Brazil622d11.p1k e -07 GeneDB Brazil483f03.q1k RevComp e -09 GeneDB Brazil655c08.q1k RevComp e -13 GeneDB 32 Nocua et al

97 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis Resultados y discusión Características de la secuencia parcial del maxicírculo de L. braziliensis El maxicírculo completo de L. braziliensis posee un tamaño aproximado de 23 kb como se observa claramente en las digestiones realizadas con las enzimas HindIII y BstBI (Figura 1). Resultados que concuerdan con lo reportado para L. tarentolae, 21 kb (10) y L. donovani, 20 kb, (11), y otros tripanosomátidos como T. brucei, 23 kb, y T. cruzi, 20 kb cepa CL Brener y 22 kb, cepa Esmeraldo (17-20). A partir de 44 secuencias previamente reportadas en diferentes bases de datos, se logró determinar gran parte de la secuencia del maxicírculo de L. braziliensis. Se ensamblaron dos fragmentos del maxicírculo, el primero con un tamaño de 6535 nt que contiene tres ARN guías (ARNg) y los ARN ribosomales (ARNr) 12S y 9S, además de codificar para las secuencias pre-editadas de las proteínas ND7, ND8, ND9, COIII, CyB y MURF5 (Figura 2, Material supl. 2A). El segundo fragmento con un tamaño de 4257 nts codifica para las secuencias correspondientes a los genes ND4, ND3 (conocido también como región G5), RPS12 y ND5, así como la región G4 (Figura 2, Material supl. 2B). La separación entre ambos fragmentos no es conocida, aunque su tamaño aproximado se puede deducir si se considera que los genes ND4 y CyB en L. tarentolae están separados por 6672 nt (10). La organización genómica de la secuencia parcial del maxicírculo de L. braziliensis, esquematizada en la Figura 2, es bastante similar a la de L. tarentolae tanto en el orden (12S, 9S, ND8, ND9, MURF5, ND7, COIII, CyB G4, ND4, ND3, RPS12 y ND5), como en la posición, longitud y secuencia de los genes. Figura 1. Estimación del tamaño en pares de bases del maxicírculo de L. braziliensis mediante ensayo de Southern blot. El ADN digerido con las diferentes enzimas de restricción se hibridó con una sonda que contiene155 nts correspondiente a la secuencia pre-editada del gen ND8 de L. braziliensis. Marcador de peso molecular Lambda HindIII (PM) y ADN no digerido (ND). Estos resultados de Southern blot en conjunto con los resultados del patrón de restricción obtenido in silico de la secuencia ensamblada, indican que mientras las enzimas PvuII, SphI, XhoI, BamHI y PvuI no presentan diana de restricción en el genoma del maxicírculo, las enzimas HindIII y BstBI presentan una diana, linealizándolo y la endonucleasa EcoRI, dos dianas, originando dos fragmentos de restricción, uno cercano a 20 kb y otro a 3 kb. Este último no se observa en el Southern blot debido a que no es reconocido por la sonda utilizada. 33

98 Universitas Scientiarum, 2011, Vol. 16 N 1: Figura 2. Esquema de la organización del maxicírculo del L. braziliensis. La orientación de las cajas indica el sentido de la transcripción. Las flechas corresponden a los ARNg así: la 1 al gm150, la 2 corresponde al gnd7-ii, la 3 al gcyb-ii, la 4 al gmurf2-ii y la 5 al gnd7-i. G5 corresponde al gen ND3. Más aún la orientación de la transcripción de los genes parece ser idéntica, en donde los genes 12S, 9S, ND8, ND7, COIII, CyB, ND4, RPS12 y ND5, se transcriben de la hebra sentido, mientras que los genes ND9, MURF5 y ND3 son transcritos a partir de la hebra anti-sentido. Al comparar con la secuencia parcial de los maxicírculos de otras especies como L. major (cepa MHOM/SU/73/5ASKH, N de acceso al GenBank EU140338), L. donovani (cepa MHOM/ SD/62/1S-C12D, N de acceso al GenBank FJ416603) y L. amazonensis (cepa LV78, N de acceso al GenBank HM439238) también se observaron resultados similares con excepción de algunas diferencias en el tamaño de las secuencias pre-editadas (Tabla 2). Por ejemplo, en relación a L. donovani se observan diferencias de 70 nts en los genes ND8 y CyB; mientras que en comparación con L. major las diferencias más notorias se presentaron con los genes ND8, ND9 y MURF5. Cabe resaltar que si bien la secuencia que codifica para MURF5 no ha sido descrita en el maxicírculo de L. donovani, esta fue identificada en este estudio en las posiciones de la hebra antisentido, mediante un alineamiento con el gen respectivo de L. tarentolae. Al extender el análisis a otros tripanosomátidos como T. cruzi (cepa CL Brener, N de acceso al GenBank DQ y cepa Esmeraldo, N de acceso al GenBank DQ343646) y T. brucei (cepa EATRO 427, N de acceso al GenBank M94286) se observaron diferencias marcadas con relación al tamaño de las regiones pre-editadas de los genes codificantes para ND7 y COIII presentando diferencias de nts. También se observó variabilidad en relación a los genes ND8 y ND9 cuyo tamaño se conserva en T. cruzi pero no en T. brucei. A diferencia de la secuencia de CyB; el resto de las secuencias presentan diferencias hasta de 150 nts. Con relación a los kinetoplástidos P. serpens y C. fasciculata se encontraron diferencias en el tamaño de todas las regiones pre-editadas reportadas con un rango de 25 a 462 nts de diferencia (Tabla 2). Los anteriores resultados muestran una considerable sintenia de los genes del maxicírculo entre las distintas especies del parásito que infectan lagartos y mamíferos, independientemente del subgénero. Así mismo, el elevado porcentaje de similitud entre los genes pre-editados tanto en longitud como en secuencia sugiere patrones similares de edición entre las distintas especies. En este mismo sentido, las diferencias encontradas con otros géneros de tripanosomátidos como Trypanosoma, P. serpens y C. fasciculata, presuponen patrones de edición más distantes entre los mismos. Secuencias pre-editadas Secuencia pre-editada de la proteína ND8: anteriormente conocida como región G1, en L. tarentolae, esta secuencia se caracteriza por sufrir pan-editing, es decir edición extensiva a lo largo de toda la molécula (11, 22, 29, 32). Al comparar la secuencia pre-editada de L. braziliensis con la correspondiente en L. tarentolae se observó una identidad de 65,2%, valores muy cercanos a los observados al comparar con las regiones equivalentes en L. donovani y L. major, pero más distantes a los resultados obtenidos con otros tripanosomátidos, especialmente para T. brucei y P. serpens (Tabla 3). De especial interés, Ramírez et al. mostraron como los ARN respectivos de este gen sufren edición, alcanzando una identidad del 91,9% con respecto a la secuencia de L. tarentolae en la región editada (29). Secuencia pre-editada de la proteína ND9: también conocida como G2, esta secuencia, al igual que para la secuencia codificante de la proteína ND8 en L. tarentolae, presenta una edición extensiva del mismo (11, 22, 32). Los porcentajes de identidad de la secuencia pre-editada de L. braziliensis resultaron ser de 71,9%, 71,2%, 66,5% y 53,4% con las secuencias de L. tarentolae, L. donovani, L. amazonensis y L. major, respectivamente. Al comparar con el resto de secuencias de las especies de tripanosomátidos analizados se observaron porcentajes de identidad inferiores, entre 43,9 y 55,3% (Tabla 3). Secuencia pre-editada del marco de lectura abierto MURF5: estudios recientes de Maslov (22) indican que esta secuencia parece no sufrir edición en tripanosomátidos. Sin embargo, se constató que existe una variabilidad significativa tanto en su extremo amino como carboxilo 34 Nocua et al

99 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis Tabla 2. Comparación de las secuencias pre-editadas del maxicírculo de L. braziliensis con otras especies de tripanosomátidos ESPECIES Genes y L. L. L. L. L. T. cruzi T. cruzi T. P. C. secuencias braziliensis tarentolae donovani amazonensis major CL Brener Esmeraldo brucei serpens fasciculata 12S ARNr Posición Tamaño (nt) S ARNr Posición Tamaño (nt) ND8 Posición Tamaño (nt) Codón Inicio AUG AUG* AUG AUG* AUG ND9 Posición Tamaño (nt) Codón Inicio AUG* AUG AUG* MURF5 Posición Tamaño (nt) Codón Inicio AUG UUG UUG UUG AUG AUG ND7 Posición Tamaño (nt) Codón Inicio UA AUA AUA AUA AUA UGA* AUU* ACG* COIII Posición Tamaño (nt) Codón Inicio AUG AUG* AUG AUG AUG AUG* AUG* CyB Posición Tamaño (nt) Codón Inicio AUG AUG* AUG AUG UUA AUG* UG* G4 Posición Tamaño (nt) Codón Inicio AUG* AAU AUG ND4 Posición Tamaño (nt) Codón Inicio AUG* AUG AUG AUG AUG AUG ND3 (G5) Posición Tamaño (nt) Codón Inicio UUU* AUG UCA* RPS12 Posición Tamaño (nt) Codón Inicio AUU AUU AUU AUG* AUG* AUG* ND5 Posición Tamaño (nt) Codón Inicio AUG* AUG AUG* AUG* AUG* Estas posiciones corresponden a la segunda secuencia descrita. Tomado de Ramírez et al., 2010 (29) * Tomado de base de datos Simpson et al.,1998 (30) Tomado de Maslov 2010 (22) Tomado de Yatawara et al., 2008 (21) Tomado de Neboháèová, 2008 (11) Tomado de Blum et al., 1990 (31) 35

100 Universitas Scientiarum, 2011, Vol. 16 N 1: Tabla 3. Porcentaje de identidad de las secuencias pre-editadas de L. braziliensis con las reportadas para otros tripanosomátidos ESPECIE GEN ND8 ND9 MURF5 ND7 COIII CyB G4 ND4 ND3 RPS12 ND5 L. tarentolae 65,2 71,9 71,6 87,3 87,3 90,5 62,9 84,4 55,2 71,8 83,7 L. donovani 66,7 71,2 62,8 86,3 84,5 88,4 67,4 84,9 62,9 65,8 83,5 L. amazonensis 76 66,5 72,5 86,3 85,7 89,7 66,9 67,8 70,2 L. major 66,1 53,4 67,3 87,2 84,7 89,1 T. cruzi CL Brener 59 50,7 38,3 42,9 30,6 82,4 50,4 76,7 41,6 41,8 74,1 T. cruzi Esmeraldo 58,4 50,4 38,3 43,2 30,8 82,5 44,8 71,6 45,7 42,1 74,2 T. brucei 51,6 55,3 52,5 41,7 31,5 84,3 45,6 76, ,2 76,8 C. fasciculata 27,9 79,7 39,1 57,5 P. serpens 56,5 43,9 45,6 78,1 42,9 73,2 30,3 49,8 terminal entre las distintas especies de Leishmania y kinetoplástidos en general (22). Así, al realizar un alineamiento múltiple de la secuencia de L. braziliensis con las previamente reportadas, esta parece ser la situación en esta especie (Figura 3). Llamativamente, a semejanza de T. brucei y P. serpens, el codón de inicio de este marco de lectura parece corresponder a la tradicional metionina, en lugar de la leucina reportada en L. tarentolae, L. donovani, L. major y L. amazonensis (10, 11, 21, 22). A este respecto es importante señalar que al igual que para otros ADN mitocondriales el código genético del ADNk rompe con las reglas del código universal, en el sentido de que la tripleta UGA no representa un codón de terminación sino que codifica para el aminoácido triptófano (10), además de las tripletas que codifican para codones de inicio diferentes a la metionina como las codificantes para leucina e isoleucina (33-35). Queda por definir si la variabilidad de los extremos de la proteína putativa MURF5 ejerce algún impacto en su posible función. Sin embargo, análisis in silico de dominios funcionales putativos muestran que esta proteína presenta un dominio trans-membrana, localizado en la región conservada de la misma. Secuencia pre-editada de la proteína ND7: en L. tarentolae esta secuencia presenta edición en el extremo 5 de la molécula y en una región interna 170 nts corriente abajo del AUA de inicio (22). Al alinear la región pre-editada de L. braziliensis con la secuencia editada de L. tarentolae y realizar la simulación del proceso de edición in silico (Figuras 4A y 4B), se observó que esta secuencia puede presentar el mismo patrón de edición, común a las otras especies del parásito reportadas. L.m L.d L.t L.b T.b P.s YKK NLFLHKFLNLKFNNNIINIMYKIKFIFN LYCIDNYNSIYFNLNGILLWLNIL KG FLFIYKLSKLNNYNN YKIKLLFNNYIYCIDNYNSIYFNLNGILIWLNIL STYTVTNYHKKNIILFIHKILKLNTFNCTS WKIILLLNN-LYCVDNYNSIYFNLNGILLWLNLL NLK -MFTYKLHKKKFYFLN -KINKFFNT-LHCIDIYNTIYFNLNGILLWLNII MFLIHFVHYKTILQ KYTFKFKHIFLSIDKYNSLFFNISGILIWLNII MFLYYKPNNITTVAVLTYN-SFSFTIQK-YHCIDICMHLFLRLYGVFIWLNLS L.m L.d L.t L.b T.b P.s H I N IILVK Y S FLIL L NNL EYL I I FFIINCLY HINIILIKYSFLILLNNLEYLIIFFIINMIYIYNLKRLLSFGRREEREGEEGS HINIIIIKYSFLILL NNLEYLII FFLYNLISIKYKDV H I N IILIK Y S FLIL L NNL EYY L I ISNI H I N IILIK Y S FFIL I NNF EYL I I LIST LVNVLLIKQNYFYLINNLEYFIISLFKLLINIKWGGG-FKWGERGRGGVLVGKEEGKIEGVRLEKGF Figura 3. Alineamiento múltiple de la secuencia de aminoácidos de MURF5 de L. braziliensis (L.b) con sus homólogos en L. amazonensis (L.m), L. donovani (L.d), L. tarentolae (L.t), T. brucei (T.b) y P. serpens (P.s). Las posiciones fuertemente conservadas se encuentran en cursiva, en negrita se encuentran los aminoácidos con cambios conservados y subrayados los aminoácidos con cambios no conservados. 36 Nocua et al

101 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis $ L.b L.t L.b L.t L.b L.t L.b L.t L.b L.t AA AGCAGACUACAUGAAAAAUAUAA AAAGG CACUUGUAUAGAU : ::: ::::::: :: :: :::: :: : ::::::::::::: AUUUUAUUUAGCCGACUACACGAUAAUUAUAUUUUAUAUUUAUUAAUUGUUUUUUUACACUUGUAUAGAU UUACAUUUGGUCCACAACAUCCUGCAGCUCAUGGUGUAUUAUGUUGUUUAUUGUAUCUUUCAGGUGAGUU :::: :: :: :: :: ::::: ::::: ::::: ::::::::::::::::: :::::::: :: :: :: UUACUUUCGGACCCCAGCAUCCAGCAGCCCAUGGCGUAUUAUGUUGUUUAUUAUAUCUUUCUGGAGAAUU UAUAAUGUAUAUAGAUGUUAUUAUAGGAUAUUUACACCGUGGCACAGAAAAGUUAUGUGAAUAUAAAACA ::::: :::::::::::: ::::: :: :::::::: :: :: ::::::::::::::::::::::::::: UAUAACGUAUAUAGAUGUAAUUAUUGGGUAUUUACAUCGAGGUACAGAAAAGUUAUGUGAAUAUAAAACA GUUGAACAGUGUUUACCGA----UGA-AGA :: :: :::::::::::: ::: ::: GUAGAGCAGUGUUUACCGUAUUUUGAUAGA UUAGUUGCUGUUAUUGGUAAUGUUGAUGUUGUUUUUGGAUCAGUUGAUCGAUAG-- ::::: :: ::::: :: :::::::::::::::::::: :: ::::: : :: UUAGUAGCAGUUAUCGGAAAUGUUGAUGUUGUUUUUGGUUCUGUUGACAGGUAAAU % L.b L.t L.b L.t L.b L.t L.b L.t L.b L.t AA AGCAGACuACAUGAAAAuuAuAuuuUAuAuuuAuuAAuuGuuuuuuuGCACUUGUAUAGAU :::::::::::: ::::::: :: :: ::::::::::::::::::::::::::::: ::::::::::::: AUUUUAUUUAGCCGACUACACGAUAAuuAUAuuuUAuAuuuAuuAAuuGuuuuuuuACACUUGUAUAGAU UUACAUUUGGUCCACAACAUCCUGCAGCUCAUGGUGUAUUAUGUUGUUUAUUGUAUCUUUCAGGUGAGUU :::: :: :: :: :: ::::: ::::: ::::: ::::::::::::::::: :::::::: :: :: :: UUACUUUCGGACCCCAGCAUCCAGCAGCCCAUGGCGUAUUAUGUUGUUUAUUAUAUCUUUCUGGAGAAUU UAUAAUGUAUAUAGAUGUUAUUAUAGGAUAUUUACACCGUGGCACAGAAAAGUUAUGUGAAUAUAAAACA ::::: :::::::::::: ::::: :: :::::::: :: :: ::::::::::::::::::::::::::: UAUAACGUAUAUAGAUGUAAUUAUUGGGUAUUUACAUCGAGGUACAGAAAAGUUAUGUGAAUAUAAAACA GUUGAACAGUGUUUACCGuAuuuUGAuAGA :: :: :::::::::::: ::: ::: GUAGAGCAGUGUUUACCGuAuuuUGAuAGA UUAGUUGCUGUUAUUGGUAAUGUUGAUGUUGUUUUUGGAUCAGUUGAUCGAUAG ::::: :: ::::: :: :::::::::::::::::::: :: ::::: : :: UUAGUAGCAGUUAUCGGAAAUGUUGAUGUUGUUUUUGGUUCUGUUGACAGGUAAAU

102 Universitas Scientiarum, 2011, Vol. 16 N 1: & L.b L.t L.b L.t L.b L.t L.b L.t L.b L.t L.b L.t ILFSRLHENYILYLLIVFLHLYRFTFGPQHPAAHGVLCCLLYLSGEFIMYIDVIIGYLHRGTEKLCEYKTVEQC :::::::.:::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::: ILFSRLHDNYILYLLIVFLHLYRFTFGPQHPAAHGVLCCLLYLSGEFITYIDVIIGYLHRGTEKLCEYKTVEQC LPYFDRLDYVSVVCNEHLLSLCFEYMLRCCLAIRCAFMRLLMCEFTRCFNGLLCCSCMVMDIGSLSPMLWSFEE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: LPYFDRLDYVSVVCNEHLLSLCFEYMLRCCLAIRCAFMRLLMCEFTRCFNGLLCCSCMVMDIGSLSPMLWSFEE RDKLMTFFDLCCGCRMHLAFMCLLGLLDDFVFGFVDFLLMLCISCLFVLDLYDLLFIGNRFLYLRLRGLAFFDV ::::::::::::::::::::::::::::::::::.:::::::::::::::::::::.:::.::::::::::::. RDKLMTFFDLCCGCRMHLAFMCLLGLLDDFVFGFIDFLLMLCISCLFVLDLYDLLFVGNRLLYLRLRGLAFFDI FDLCFNSISGCLSRSLGMVWDVRLYSSYELYFILVFDYCFCYLGDAFDRFFLRLFDMRLVAVIGNVDVVFGSVD :::::::::::::::::::::::::: :::::.::::::::::::::::.::::::::.... : FDLCFNSISGCLSRSLGMVWDVRLYSCYELYFMLVFDYCFCYLGDAFDRLFLRLFDMRMSILLCKQCFFVGFFV R---CLFDYMYVDITIETIISLFYSLWCCILPGCSFANVEHPKGEYSIFLCFLYGFISRLRIRCADFIHICLLD :::::::::.:::::::::::::::::::::::::::::::::.:::::::::::::::::::.:::::: FGFVCLFDYMYVDVTIETIISLFYSLWCCILPGCSFANVEHPKGEYSLFLCFLYGFISRLRIRCADFVHICLLD VMMRGFMIHDMSILLCKQCFFIGFFVFGFV :::::::.::.....: VMMRGFMLHDLVAVIGNVDVVFGSVDR Figura 4. Edición in silico de la secuencia ND7 de L. braziliensis. (A) Alineamiento de secuencias de nucleótidos entre L. braziliensis (pre-editada) y L. tarentolae (editada). (B) Alineamiento entre las secuencias editadas de L. braziliensis y L. tarentolae. (C) Alineamiento entre las secuencias de aminoácidos correspondientes a L. braziliensis y L. tarentolae. Las líneas indican la continuidad de las secuencias. Más aún, al comparar la secuencia putativa de aminoácidos resultante de la edición in silico de L. braziliensis con la secuencia reportada para otras leishmanias, se observó un porcentaje de identidad de 87,2% (Figura 4C), estando al igual que en otras especies del parásito, las divergencias ubicadas en el extremo carboxi terminal de la proteína. De especial interés, al igual que lo reportado para L. tarentolae, L. amazonensis y L. major, el codón de inicio de esta proteína parece corresponder al aminoácido no canónico isoleucina, al igual que en P. serpens (AF079967). Por otra parte, al comparar las regiones pre-editadas con las otras especies del parásito se encontraron porcentajes de identidad similares (86,7 87,3%, Tabla 3). Por el contrario, los porcentajes obtenidos con las otras especies de tripanosomátidos estuvieron alrededor del 40%, posiblemente debido al pan-editing que sufren estas secuencias en T. cruzi (DQ y DQ343646) y T. brucei (M94286). Secuencia pre-editada de la proteína COIII: esta secuencia al igual que la respectiva de la proteína ND7, sufre edición en el extremo 5 de la molécula en las diferentes especies del parásito reportadas (11, 22, 36). Al realizar el alineamiento entre la secuencia pre-editada de L. braziliensis y la editada de L. tarentolae se observó el mismo patrón de edición (Figuras 5A y 5B), observándose un porcentaje de similitud de 89,2% (Figura 5C), Resultado coherente con los porcentajes de identidad obtenidos al comparar las secuencias pre-editadas con las especies analizadas los cuales variaron entre 84,5 87,3% (Tabla 3). Al igual que para la secuencia ND7, el porcenta- 38 Nocua et al

103 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis je de similitud fue significantemente más bajo con las secuencias de T. brucei y T. cruzi, debido a que el patrón de edición difiere significativamente del de las especies de Leishmania (37). Secuencia pre-editada de la proteína CyB: esta secuencia también sufre edición en el extremo 5 en todos los tripanosomátidos analizados. $ L.b L.t L.b L.t L.b L.t % L.b L.t L.b L.t L.b L.t AGGGUUUUCCGGAAGGGGUGAUUUUGUU UGUUUUUGUUUGGUCUACUUUACCUGCUAUCUGUA : : :: : :: : : ::::::: ::::::::::: : ::::::::::::: :: : AUGUUUGUUCGU----GUUAUUUUUGUUGGUGUGAGUGGUGUUUUUGUUUUUUUGUCUUUACCUGCUAUUUGCA UUACAUAUUUAGCAUUUUGUUUAUGUAGUUUAUUUUGUAUUAUGUU : ::::::: : :::::::::::: : :: :::::::::::::: UAGUAUAUUUAACUUUUUGUUUAUGUGGAUUGUUUUGUAUUAUGUU UUUUUUAUUACGGUUUGUAUAUUUUGAUGUAUUAAAUGUAGUGUAUUUAUGUAUAUAA :::::::::::: ::::::::::::::::: :::: :::::: :: :::: : :::: UUUUUUAUUACGAUUUGUAUAUUUUGAUGUGUUAAGUGUAGUAUACUUAUAUGCAUAA AuGGuGCuuCGuGAuAuuuuuGuuGGuGUGAGUGGUGuuuuuGuuuuuuuCACUUUACCUGCUAUCUGUAUUAC ::: : :::::: :::::::::::::::::::::::::::::::::::: ::::::::::::: :: :: AuGuuuGuuCGuGuuAuuuuuGuuGGuGUGAGUGGUGuuuuuGuuuuUUUGUCUUUACCUGCUAUUUGCAUAGU AUAUUUAGCAUUUUGUUUAUGUAGUUUAUUUUGUAUUAUGUUUAGU ::::::: : :::::::::::: : :: ::::::::::::::: :: AUAUUUAACUUUUUGUUUAUGUGGAUUGUUUUGUAUUAUGUUUGGU UUUGAUUUUUUUUAUUACGGUUUGUAUAUUUUGAUGUAUUAAAUGUAGUGUAUUUAUGUAUAUAA ::::::::::::::::::: :::::::::::::::::::: : :::::: :: :::: : :::: UUUGAUUUUUUUUAUUACGAUUUGUAUAUUUUGAUGUGUUAAGUGUAGUAUACUUAUAUGCAUAA & L.b L.t L.b L.t MVLRDIFVGVSGVFVFFTLPAICITYLAFCLCSLFCIMFSSFIFIDYCFICFFACLLFCLICLICDLFVDTLRG :.: :::::::::::..::::::.::.::::.::::::.::::::::::::::::::::.::.::::::.::: MFVRVIFVGVSGVFVFLSLPAICIVYLTFCLCGLFCIMFGSFIFIDYCFICFFACLLFCLVCLLCDLFVDSLRG LFDICCLIRCIQYCFVWFILSELFLFLSLFYVVFSLILFVSVEFAFIFVIPIMFSCLICDFGFVFYWYFIDVFN :::.::.::::::::::::.:::.::::::::::::.:::::::::.::::.:::::::::::::::::::.:: LFDVCCFIRCIQYCFVWFIISELLLFLSLFYVVFSLVLFVSVEFAFVFVIPVMFSCLICDFGFVFYWYFIDIFN

104 Universitas Scientiarum, 2011, Vol. 16 N 1: L.b LLINTFLLFVSGLFINFVLFLFWLRFFLCVLFMLWIGILFGFLFLWNQVWEFSLLLVTCSCGIFGSILFLIDLL ::::::::::::::.::::::::.:::::::::::.::::::::::::::::.::.::::::.::::::::::: L.t LLINTFLLFVSGLFVNFVLFLFWFRFFLCVLFMLWVGILFGFLFLWNQVWEFALLFVTCSCGVFGSILFLIDLL L.b HFSHVFLGIFLLFICFSRCFNFLSMDTRFVFLYVVCLYWHFVDCVWFFLLRFVYFDVLNVVYLCI :::::::::::::.::::::::: ::::::::::::::::::::::::::::::::::.:::: L.t HFSHVFLGIFLLFLCFSRCFNFLCMDTRFVFLYVVCLYWHFVDCVWFFLLRFVYFDVLSVVYLYA Figura 5. Edición in silico de la secuencia COIII de L. braziliensis. (A) Alineamiento de secuencias de nucleótidos entre L. braziliensis (pre-editada) y L. tarentolae (editada). (B) Alineamiento entre las secuencias editadas de L. braziliensis y L. tarentolae. (C) Alineamiento entre las secuencias de aminoácidos correspondientes a L. braziliensis y L. tarentolae. Las líneas dentro de la secuencia indican la continuidad de las mismas. Así, se encontró el mismo patrón de edición en L. braziliensis al realizar un alineamiento entre la secuencia pre-editada de esta y la correspondiente en L. tarentolae (Figuras 6A y 6B), encontrándose un porcentaje de identidad de 96,5% (Figura 6C). Estos resultados se corroboraron al observase el porcentaje de identidad obtenido al comparar las secuencias pre-editadas de este gen con las correspondientes en el resto de tripanosomátidos encontrándose valores de 82,4 90,5% (Tabla 3), evidenciándose la alta conservación de esta secuencia en los diferentes géneros de la familia Trypanosomatidae. Secuencia pre-editada de la proteína ND4: en las secuencias reportadas de otros tripanosomátidos, este gen no presenta ningún tipo de edición y posee en la secuencia traducida un codón de inicio canónico conservado (AUG) (11, 22). Al analizar la secuencia de L. braziliensis se observó la falta de este codón de inicio y la presencia de algunos codones de parada dentro de la secuencia codificante. Resultados que pueden deberse o bien a un error en la secuencia reportada en las bases de datos, o a que este gen en esta especie sufra edición a lo largo del mismo. Aún así, se obtuvo un porcentaje de identidad del 84,4 84,9 % al comparar con el género Leishmania y del 71,6 76,9% al comparar con el resto de tripanosomátidos. Indicando estos resultados una fuerte conservación de este gen en las diferentes especies de tripanosomátidos analizados. Secuencia pre-editada de la proteína ND3: conocida también como región G5, en los diferentes tripanosomátidos estudiados, esta secuencia se caracteriza por sufrir panediting (11, 22, 34). De acuerdo a lo anterior, al comparar la secuencia pre-editada de L. braziliensis con las respectivas de las distintas especies del género, se observó una identidad máxima con L. amazonensis de 67,8% y de 30-55% con otros tripanosomátidos (Tabla 3). Secuencia pre-editada de la proteína RPS12: anteriormente conocida como región G6, esta secuencia también presenta edición a lo largo de la misma (11, 22) y utiliza como codón de inicio la tripleta no canónica AUU, creada $ L.b L.t L.b L.t L.b L.t AAG------CG-GAGAGAAA AGAAAA GGCUU--AACUUCAGGUUG : : :: : ::: ::::: : ::: :::::::::::: AUGUUUUUUCGUGUUAGAUUUUUGUUAUUUUUUUUAUUAUUUAGAAAUUUAUGUUGUCUUUUAACUUCAGGUUG UUUAUUGCGAAUUUAUGGUGUAGGUUUUAGUUUAGGUUUUUUUAUU :::::: ::: : ::::::::::::::::::::::::::::::::: UUUAUUACGAGUAUAUGGUGUAGGUUUUAGUUUAGGUUUUUUUAUU UGGAGUUACAAUUUUGAGUAUUAAUUUUAUUUAUGUUAAUAGUAUGUAGAUUAGAUUAG :::::::::::::::: :::::: ::::::::::: :: : ::::::::::::::::: UGGAGUUACAAUUUUGGGUAUUACUUUUAUUUAUGCUAGUUGUAUGUAGAUUAGAUUAA Nocua et al

105 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis % L.b L.t L.b L.t L.b L.t AuGuuuuuuCGuGuuAGAuuuuuGuuAuuuuuuuuAuuAuuuAGAAAuuuAuGuuGuCUUuuAACUUCAGGUUG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: AuGuuuuuuCGuGuuAGAuuuuuGuuAuuuuuuuuAuuAuuuAGAAAuuuAuGuuGuCuUUUAACUUCAGGUUG UUUAUUGCGAAUUUAUGGUGUAGGUUUUAGUUUAGGUUUUUUUAUU :::::: ::: : ::::::::::::::::::::::::::::::::: UUUAUUACGAGUAUAUGGUGUAGGUUUUAGUUUAGGUUUUUUUAUU UAUUUGAAUGGAGUUACAAUUUUGAGUAUUACUUUUAUUUAUGCUAGUUGUAUGUAGAUUAGAUUAA :: :::::::::::::::::::: :::::: ::::::::::: :: : ::::::::::::::::: CAUAUGAAUGGAGUUACAAUUUUGGGUAUUAAUUUUAUUUAUGUUAAUAGUAUGUAGAUUAGAUUAG & L.b L.t L.b L.t L.b L.t MFFRVRFLLFFLLFRNLCCLLTSGCLLRIYGVGFSLGFFICMQIICGVCLAWLFFSCFICTNWYFVLFLWDFDL ::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::: MFFRVRFLLFFLLFRNLCCLLTSGCLLRVYGVGFSLGFFICMQIICGVCLAWLFFSCFICTNWYFVLFLWDFDL GFVIRSTHICFTSLLFFLLYVHIFKSIVLIILFDTHILVWIIGFIIYIFIVIIGFIGYVLPCTMMSYWGLTVFS ::::::::::::::::::::::::: ::::::::::::::.:::::::::.:::::::::::::::::::::: GFVIRSTHICFTSLLFFLLYVHIFKCIVLIILFDTHILVWAVGFIIYIFIVVIGFIGYVLPCTMMSYWGLTVFS NILATVPVIGVWLCYWIWGSEYINDFTLLKLHVLHVLLPFILLIIIFMHLFCLHYFMSSDGFCDRFAFYCERLC ::::::::::.:::::::::::::::::::::::::::::.:...::::::::::::::::::::::::::::: NILATVPVIGTWLCYWIWGSEYINDFTLLKLHVLHVLLPFVLILVIFMHLFCLHYFMSSDGFCDRFAFYCERLC L.b FCMWFYLRDMFLAFLILFFVVYFIFINWYFVFHEESWVIVDTLKTSDKILPEWFFLFLFGFLKAVPDKFTGLLL ::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::: L.t FCMWFYLRDMFLAFLILFYVVYFIFINWYFVFHEESWVIVDTLKTSDKILPEWFFLFLFGFLKAVPDKFTGLLL L.b L.t MVILLFSLFLFILNCILWFVYCRSSLLWFTYSLILFYSIFMSGFLALYVILAYPIWMELQFWVLILFMLIVCRL ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::.:::: MVILLFSLFLFILNCILWFVYCRSSLLWFTYSLILFYSIFMSGFLALYVILAYPIWMELQFWVLLLFMLVVCRL L.b : L.t D D Figura 6. Edición in silico de la secuencia CyB de L. braziliensis. (A) Alineamiento de secuencias de nucleótidos entre L. braziliensis (pre-editada) y L. tarentolae (editada). (B) Alineamiento entre las secuencias editadas de L. braziliensis y L. tarentolae. (C) Alineamiento entre las secuencias de aminoácidos correspondientes a L. braziliensis y L. tarentolae. Las líneas indican la continuidad de las secuencias. 41

106 Universitas Scientiarum, 2011, Vol. 16 N 1: durante el proceso de edición. Para L. braziliensis, se observaron porcentajes de identidad para la secuencia preeditada de 70,2-71,8% con las otras especies de este parásito, mientras que para las otras especies de tripanosomátidos se obtuvieron porcentajes de identidad que variaron entre 40,2 y 42,1%. (Tabla 3). Secuencia pre-editada de la proteína ND5: diferentes reportes indican que esta secuencia génica no sufre ningún proceso de edición (17, 22). Al comparar con la secuencia obtenida de L. braziliensis, se observó un alto grado de identidad con las secuencias reportadas para los otros tripanosomátidos estudiados variando de 74,1 a 83,7% (Tabla 3), Resultados que indican un alto grado de conservación de esta secuencia en este grupo de parásitos. Por otra parte, en la secuencia de L. braziliensis se observó la falta del codón de inicio. Sin embargo, al eliminar dos timinas ubicadas en las posiciones 2 y 3 del marco de lectura abierto, se obtuvo una secuencia de 590 aa., con un 79,8% de identidad con la secuencia de aa de la proteína de L. tarentolae (datos no mostrados), por tanto es posible que en L. braziliensis estas posiciones sean editadas, aunque no se puede descartar que se deban a algún artefacto de secuenciación. ARN guías Se encontraron cinco ARNg, el primero corresponde a un ARNg homólogo al gm150 descrito en L. tarentolae el cual fue descubierto como parte de una edición errónea y su papel en la edición es aún desconocido (38). El segundo y tercero son los denominados gnd7-ii y gnd7-i respectivamente, que como sus nombres lo indican, en L. tarentolae son los dos ARNg que participan en la edición del ARNm codificante para la subunidad ND7 (31). La modelación in silico del apareamiento de las bases entre el ARNg ND7-II y la respectiva región a guiar en el proceso de edición del ARNm de ND7, apoya la existencia del patrón de edición anteriormente sugerido (Figura 7A). Se encontró también el ARNg CyB-II que en L. tarentolae se ha visto es el segundo ARNg que participa en la edición del ARNm que codifica para la proteína CyB (31). Similar a lo encontrado para gnd7, al modelar in silico la unión de este ARN con su respectivo ARNm, se evidenció claramente la región a guiar (Figura 7B). Llamativamente, para este ARNg en L. braziliensis, la región codificante inicia en el extremo 3 del gen que codifica para el 9S (Figura 2), al igual que para L. tarentolae. Sin embargo, en L. major estas regiones codificantes no se sobrelapan pero tampoco existe una región intergénica que las separe (21). Con relación al ARNg respectivo de L. donovani, este gen se ubica en la hebra sentido a diferencia de las otras especies. Por último, se encontró el gmurf2-ii, que como su nombre lo indica participa en la edición del marco de lectura abierto MURF2. Como se puede observar en la Tabla 4 las secuencias de todos los ARNg se conservan entre 52,7 83,7% en relación a otras especies del parásito y entre 45,3-65,4% al comparar con otros tripanosomátidos. Resultados que apoyan un patrón de edición compartido por distintas especies del género Leishmania y más disímil al compararse entre miembros de la familia Trypanosomatidae. ARN ribosomales Dentro de la secuencia del maxicírculo se encontraron los ARNr 12S y 9S, de los cuales se conoce que en otras especies del parásito participan en la síntesis proteica que tiene lugar en la única mitocondria de estos kinetoplástidos (4, 19). Estos ARN son muy similares en cuanto a tamaño y ubicación en las distintas especies analizadas (Tabla 2); presentando incluso identidades en su secuencia entre 88,7 A. B. Figura 7. Representación del apareamiento de los ARNg presentes en el maxicírculo de L. braziliensis con las regiones a editar en el ARNm. A. gnd7-ii. B. gcyb-ii. La adición de uridinas se representan con u, los nucleótidos de adenosina y guanosina que guían las ediciones se representan con a y g. Los apareamientos de pares de bases estándar se representan con líneas sólidas, el apareamiento G-U se representa con dos puntos. 42 Nocua et al

107 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis Tabla 4. Porcentaje de identidad de los ARN del maxicírculo de L. braziliensis, comparados con otras especies de tripanosomátidos. ESPECIE ARN 12S ARNr 9S ARNr ARNg gnd7-ii gcyb-ii gmurf2-ii gnd7-i L. tarentolae 88,7 92,5 83,7 73,9 79,2 78,2 62,1 L. donovani 92 67,9 53,6 51,7 L. amazonensis 92,7 52,7 L. major 91,4 83% T. cruzi CL Brener 78,5 81,3 64, ,9 62,5 T. cruzi Esmeraldo 77,9 81, , ,3 45,2 T. brucei 77,7 82,2 65,4 53,1 64,2 66,7 48,5 C. fasciculata 80,7 81,9 P. serpens 77,8 77,7 55,1 62,2 45,3 77,8 y 92,5% (Tabla 4). Al comparar con otros tripanosomátidos, si bien el ARNr 9S prácticamente conserva su tamaño, los porcentajes de identidad disminuyen a 77,7 82,2% (Tablas 2 y 4). Por su parte, el ARNr 12S presenta variabilidad tanto en su tamaño, con un rango del nucleótidos (Tabla 2), como en su secuencia, con un porcentaje de identidad de 77,7 a 80,7% (Tabla 4). Regiones intergénicas Como se observa en la tabla 5 se identificaron 5 regiones intergénicas que separan las secuencias codificantes de 12S y 9S, 9S y ND8, ND7 y COIII, COIII y CyB y RPS12 y ND5 para todas las especies de tripanosomátidos analizadas, observándose que en general son regiones cortas con un promedio de nt con variaciones en tamaño entre las distintas especies del género de nt. Tamaños que pueden obedecer a la necesidad de tener un genoma compacto; a diferencia de los genes nucleares en donde se observan regiones intergénicas extensas dada la necesidad de codificar en las mismas los elementos implicados en la regulación de la expresión espacio temporal (39). Finalmente, a diferencia de la elevada conservación de las secuencias pre-editadas tanto en secuencia como en longitud, estas regiones presentan una mayor variabilidad, resultado de esperarse teniendo en cuenta que en líneas generales, la presión evolutiva actúa preferencialmente en las regiones codificantes y secuencias regulatorias de los genomas. Tabla 5. Características de las regiones intergénicas presentes en el maxicírculo de L. braziliensis comparadas con las encontradas en otros tripanosomátidos. ESPECIES Regiones Intergénicas L. L. L. L. L. T. cruzi T. cruzi T. P. C. braziliensis tarentolae donovani amazonensis major CL Brener Esmeraldo brucei serpens fasciculata 12S ARNr- Posición S ARNr Tamaño (nt) S ARNr-ND8 Posición Tamaño (nt) ND7-COIII Posición Tamaño (nt) COIII-CyB Posición Tamaño (nt) RPS12-ND5 Posición Tamaño (nt)

108 Universitas Scientiarum, 2011, Vol. 16 N 1: Conclusiones A pesar de ser L. braziliensis la especie más divergente del género Leishmania en cuanto a su genoma nuclear, el maxicírculo presenta una elevada conservación de su secuencia, la cual incluso aumenta a nivel de aminoácidos, luego del proceso de edición del ARNm. Resultado que indica la conservación en la función de sus genes. Adicionalmente, los resultados de este trabajo señalan que el patrón de edición presente en las diferentes especies del parásito hasta ahora estudiadas se extiende al subgénero Viannia, sugiriendo un patrón común de edición a nivel de género. Financiación Este trabajo fue financiado con recursos del Departamento Administrativo de Ciencia Tecnología e Innovación- Colciencias, Proyecto Paola Andrea Nocua Martínez fue financiada por el Programa de Jóvenes Investigadores e Innovadores y la Pontifica Universidad Javeriana, convocatoria Conflicto de intereses Los autores afirman no tener ningún conflicto de intereses. Referencias 1. Velez ID, Hendrickx E, Robledo SM, Agudelo S. Leishmaniasis cutánea en Colombia y género. Cadernos de Saúde Pública 2001; 17, WHO. Leishmaniasis home. leishmaniasis/en/. Consultado el 16 de octubre de Shalomai J. The structure and replication of kinetoplast DNA. Current Molecular Medicine 2004; 4 (6): Simpson L. Kinetoplast DNA in trypanosomatid flagellates. International Review of Cytology 1986; 99, Simpson L. The mitochondrial genome of kinetoplastid protozoa: genomic organization, transcription, replication and evolution. Annual Review of Microbiology 1987; 41, Lukeš J, Guilbride DL, Votýpka J, Zíková A, Benne R, Englund PT. Kinetoplast DNA network: evolution of an probable structure. Eukaryotic Cell 2002; 1 (44): Muhich ML, Neckelmann N, Simpson L. The divergent region of the Leishmania tarentolae kinetoplast maxicircle DNA contains a diverse set of repetitive sequences. Nucleic Acids Research 1985; 13 (9): Flegontov PN, Guo Q, Ren L, Strelkova VM. Conserved repeats in the kinetoplast maxicircle divergent region of Leishmania sp. and Leptomonas seymouri. Molecular Genetics & Genomics2006; 276, Bhat GJ, Koslowsky DJ, Feagin JE, Smiley BL, Stuart K. An extensively edited mitochondrial transcript in kinetoplastids encodes a protein homologous to ATPase subunit 6. Cell 1990; 61 (5): De la Cruz FV, Neckelmann N, Simpson L. Sequence of six genes and several open reading frames in the kinetoplast maxicircle DNA of Leishmania tarentolae. The Journal of Biological Chemistry 1984; 259 (24): Neboháèová M, Kim CE, Simpson L, Maslov D. RNA editing and mitochondrial activity in promastigotes and amastigotes of Leishmania donovani. International Journal for Parasitology 2009; 39, Shaw JM, Feagin JE, Stuart K, Simpson L. Editing of kinetoplastid mitochondrial mrnas by uridine addition and deletion generates conserved amino acid sequences and AUG initiation codons. Cell 1998; 6 (53): Estévez AM, Simpson L. Uridine insertion/deletion RNA editing in trypanosome mitochondria - a review. Gene 1999; 240, Stuart KD, Schnaufer A, Ernst NL, Panigrahi AK. Complex management: RNA editing in trypanosomes. Trend in Biochemical Sciences 2005; 30 (2): Cruz-Reyes J, Sollner-Webb B. Trypanosome U- deletional RNA editing involves guide RNA-directed endonuclease cleavage, terminal U exonuclease, and RNA ligase activities. Proceedings of the National Academic of Sciences USA. 1996; 93 (17): Lukeš J, Hashimi H, Zíková A. Unexplained complexity of the mitochondrial genome and transcriptome in kinetoplastid flagellates. Current Genetics 2005; 48 (5): Eperon IC, Janssen JW, Hoeijmakers JH, Borst P. The major transcripts of the kinetoplast DNA of Trypanosoma brucei are very small ribosomal RNAs. Nucleic Acids Research 1983; 1 (1): Benne R, De Vries BF, Van den Burg J, Klaver B. The nucleotide sequence of a segment of Trypanosoma brucei mitochondrial maxi-circle DNA that contains the gene for apocytochrome b and some unusual unassigned reading frames. Nucleic Acids Research 1983; 11 (20): Sloof P, Van den Burg J, Voogd A, Benne R, Agostinelli M, Borst P, Gutell R, Noller H. Further characteriza- 44 Nocua et al

109 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis tion of the extremely small mitochondrial ribosomal RNAs from trypanosomes: a detailed comparison of the 9S and 12S RNAs from Crithidia fasciculata and Trypanosoma brucei with rrnas from other organisms. Nucleic Acids Research 1985; 13 (11): Westenberger SJ, Cerqueira GC, El-Sayed NM, Zingales B, Campbell DA, Sturm NR. Trypanosoma cruzi mitochondrial maxicircles display species- and strain-specific variation and a conserved element in the non-coding region. BioMed Central Genomics 2006; 7 (60): Yatawara L, Le TH, Wickramasinghe S, Agatsuma T. Maxicircle (mitochondrial) genome sequence (partial) of Leishmania major: gene content, arrangement and composition compared with Leishmania tarentolae. Gene 2008; 424 (1-2): Maslov DA. Complete set of mitochondrial pan-edited mrnas in Leishmania mexicana amazonensis LV78. Molecular and Biochemical Parasitology 2010; 173 (2): Sloof P, van den Burg J, Voogd A, Benne R. The nucleotide sequence of a 3.2 kb segment of mitochondrial maxicircle DNA from Crithidia fasciculata containing( mal separada en galeradas) the gene for cytochrome oxidase subunit III, the N-terminal part of the apocytochrome b gene and a possible frameshift gene; further evidence for the use of unusual initiator triplets in trypanosome mitochondria. Nucleic Acids Research 1987; 15 (1): van der Spek H, Arts GJ, Zwaal RR, van den Burg J, Sloof P, Benne R. Conserved genes encode guide RNAs in mitochondria of Crithidia fasciculata. The EMBO Journal 1991; 10 (5): Maslov DA, Hollar L, Haghighat P, Nawathean P. Demonstration of mrna editing and localization of guide RNA genes in kinetoplast-mitochondria of the plant trypanosomatid Phytomonas serpens. Molecular and Biochemical Parasitology 1998; 93 (2): Maslov DA, Nawathean P, Scheel J. Partial kinetoplastmitochondrial gene organization and expression in the respiratory deficient plant trypanosomatid Phytomonas serpens. Molecular and Biochemical Parasitology 1999; 99 (2): Requena JM, López MC, Jimenez-Ruiz A, de la Torre JC, Alonso C. A head-to-tail tandem organization of hsp70 genes in Trypanosoma cruzi. Nucleic Acids Research 1988; 16 (4): Sambrook J, Rusell DW. Molecular cloning: a laboratory manual. Third edition. Cold spring Harbor Laboratory press. New York, USA. 2001, Tomo 3, 6.41 p. 29. Ramírez C, Puerta C, Requena JM. Evidence of RNA editing in Leishmania braziliensis promastigotes. Parasitology Research 2010; 108: Simpson L, Wang S, Thiemann OH, Alfonzo JD, Maslov DA, Avila HA. U-insertion/deletion edited sequence database. Nucleic Acids Research 1998; 26 (1): Blum B, Bakalara N, Simpson L. A model for RNA editing in kinetoplastid mitochondria: guide RNA molecules transcribed from maxicircle DNA provide the edited information. Cell 1990; 60 (2): Gao GG, Kapushoc ST, Simpson AM, Thiemann OH, Simpson L. Guide RNAs of the recently isolated LEM125 strain of Leishmania tarentolae: an unexpected complexity. RNA 2001; 7, Okimoto R, Macfarlane JL, Wolstenholme DR. Evidence for the frequent use of TTG as the translation initiation codon of mitochondrial protein genes in the nematodes, Ascaris suum and Caenorhabditis elegans. Nucleic Acids Research 1990; 18 (20): Corell RA, Myler P, Stuart K. Trypanosoma brucei mitochondrial CR4 gene encodes an extensively edited mrna with completely edited sequence only in bloodstream forms. Molecular and Biochemical Parasitology 1994; 64 (1): Read LK, Wilson KD, Myler PJ, Stuart K. Editing of Trypanosoma brucei maxicircle CR5 mrna generates variable carboxy terminal predicted protein sequences. Nucleic Acids Research 1994; 22 (8): Shaw JM, Feagin JE, Stuart K, Simpson L. Editing of kinetoplastid mitochondrial mrnas by uridine addition and deletion generates conserved amino acid sequences and AUG initiation codons. Cell 1988; 53 (3): Feagin JE, Shaw JM, Simpson L, Stuart K. Creation of AUG initiation codons by addition of uridines within cytochrome b transcripts of kinetoplastids. Proceedings of the National Academy of Sciences USA 1988; 85 (2): Sturm NR, Maslov DA, Blum B, Simpson L. Generation of unexpected editing patterns in Leishmania tarentolae mitochondrial mrnas: misediting produced by misguiding. Cell 1992; 70 (3): Holzer TR, Mishra KK, LeBowitz JH, Forney JD. Coordinate regulation of a family of promastigote enriched mrnas by the 3 UTR PRE element in Leishmania mexicana. Molecular and Biochemical Parasitology 2008; 157 (1):

110 Universitas Scientiarum, 2011, Vol. 16 N 1: Material Suplementario 1 5 GATCATGACCAAGATGTACCAGAGAGGTTTCGGG AATCAGCGATTTTGATTGGGGGAACGGAGCCGTCGA GGAAATGCCCTAGAGCTTTAGAGCGGGAGAAGAGT TTTGGATCGACTGAAGAAAAGATCGTTTTCGGAAGG GGAGCAGGTCCAACCTTTTGATTTCTTTGCTAATCA CATCATGTTTTGTTTTATTTTGTGTTTTGGTTGCCA TGTATTTATGTGCACCATATATTTGTTTTATTTGGTT GTTGTTTTATGTTATTTGATTTTTATTTGTGTTTTGTT TAATTATTATACGAGTATTTTTTTATATTTTTTATGT AGTTTGCTTTAACAATAAAAAAGAAATTTTAAAA AAAAAAAAAAAAAAGAATTCCG 3 Material suplementario 1. Localización en el inserto del clon plb70-3u-600d (ADNc parcialmente editado del gen ND8 de L. braziliensis, número de acceso FR del EMBL-EBI/GenBank) del fragmento del gen ND8 utilizado como sonda en los ensayos de Southern blot. El fragmento fue amplificado utilizando los iniciadores Lb1824 y LbND8-R, los cuales se indican en negrita y subrayado, respectivamente. En gris se señala la región de 155 nts correspondiente al extremo 5 no editado del gen. Material Suplementario 2 2A. Tamaño: 6535 pb. ADN circular DEFINICIÓN: ADN mitocondrial del maxicírculo pre-editado de Leishmania braziliensis. FUENTE: Mitocondria Leishmania braziliensis cepa MHOM-BR-75-M2904 CARACTERÍSTICAS: Localización ARNg Cadena complementaria ( ) Homólogo al ARN guía gm150 de función desconocida, descrito en L. tarentolae ARNg Cadena complementaria ( ) ARN guía II para el ARNm de la sub-unidad 7 de la NADH deshidrogenasa; gnd7-ii ARNr S ARN ribosomal; 12S ARNr ARNr S ARN ribosomal; 9S ARNr ARNg RNA guía II para el ARNm del Citocromo b; gcyb-ii ND Gen de la sub-unidad 8 de la NADH deshidrogenasa; pre-editado ND9 Cadena complementaria ( ) Gen de la sub-unidad 9 de la NADH deshidrogenasa; pre-editado MURF5 Cadena complementaria ( ) Región pre-editada de MURF5 ND Gen de la sub-unidad 7 de la NADH deshidrogenasa; pre-editado COIII Gen de la sub-unidad 3 de la Citocromo oxidasa;pre-editado CyB Gen del Citocromo b; pre-editado ORIGEN 1 TGTTTTTTAA ATTAATTATG TATTTACTAC TAAATTTTAA TTAGTGTTTT TAATTATTTA TAAAATAATC AAAAACCACA AAAATTTATA 91 TAGAATAAAT TTATGTAATA TAAAAAATTT TGTATTGTAT ATAATTTAAA TTTTTATTGT TGTTTGTTTT ATATAATTAT TTTATATTGT 181 AAAGTTTATT TTTAAATTGT ATTTATGTAA TATAATTTTA ATACAAATTT TATTTAAAGG ATATTAAGAA TAAAATGTAT TTTAAACTAT 271 GATCAATAAA ATATAAAAAA ATTTGTTTAT AATATATTAA TTTTGTACTT TTAAAATAGA GAGTTTTAAA AAGTAATAAA ATATATTTTG 361 AATATTATTT AATTAAAATT AATAAAAAAG AAGTAAAAAT AAATATATGT ATTACTTACT AATAATTTTT TTACACTTGT ATATTTTGTT 451 ATTATTATTA TTATTTATAA TAAAGTAATA AATAGTAAAT AAATCAAAAT ATTTAAATAA ATAATATTGA TTAAAATTTT GTTTTATTAT 541 TTAATTACAT TTTTGAATTA AAATTTTATT ATTAATATTT AATAATTAAA AATATTATAT ATTTTAAATT TAAATTTGTT GTTTTATATT 631 TAGTTTTAAA TTTAAATAGT AATTAAATTA ATAATTTTAA TTTAAAATTT TACGAACTGT AATTTATAGT TTATTATTTA TAGTTTAATG 721 TTTAAATATT TAACTAGTGA AGGCACAGTT GTTCTATATG TATCAGTAAA AAATAGTAAA ATTATTTTAA TTAAATTAAT AAATAATTAT 811 TAACAAAAAT TATAATTAAT ATTATGACAA ATTTAAAAAT TAAATATTTT TTCTAATATT ATTTAATAAT TAAGGAATTA TTTAAATTGA 901 ATATTAAAAT TACGAATTTA ATTTGTAATT AATAGTTTTT ATTGAAATAA AAGTATAGAT TTATAATATT ATTAAATTTA ATTATTTTAA 991 TATTTAATAT TTGTTTATTA AAAAGTAACT TTATTGAAAT ATAAAGAATT ATTATTATTA TTATTATTTT AAAAATATAA AAATATTGTT 46 Nocua et al

111 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis 1081 AATAAAATTA TCAAGTTTCA AAAGCGTTTA TTAAATGCGT TAGTCTAAGT ATTATATTTA AGATTATTCT TGTATATAGA TTTTTATTTT 1171 AATAATCCTA TATAATTAAA AATTATCCTT AATTTATATT CATTAGTAGC ATAGTAATTT GTTAACTAAT TATTAAAGCG TTCCATAGAA 1261 AATTTTAAAA TTAAAACAAT CTAAATAATT AATAAATTAA AATAAAAATT TTAAAAAAAA TTAAAAAATT AAAATAGGGC AAGTCCTACT 1351 CTCCTTTACA AAGAGAACAT TTATATGTAT TTGTATGTTT GATTGGGGCA ATACTATATC TATTTATATA GAAAAAGAAC TATAATTATT 1441 GAAATAATAA AAGGTTCGAG CAGGTTAACA AGCATTAATA ATAAATGTGT TTCATCGTCT ACTTATTGCT AATTTAAATT GATTGTTCAT 1531 CAAAAATGCA ATTCGTTAGT TGGGTTAAAA TCGTTGTAAA GCAGATTTGT TTATATATTT AATTTTTATA TATCATTAAA AATTAATATC 1621 AGTACGCAAG GATCTATTAT TTGTTATTTT ATTTTATTTT ATTTTATTTT ATTTTATTTT ATTTTATTTT ATTTTAAAAA ATATTAAAAG 1711 TCAATTGTTA TTATTCATAT TAATTTTTTT AAAAGTTTTT TAATTTTATA TTAGTTTATT TGATTTAAAA AGATAAATGT ATTTTCAAAT 1801 TTTAGGAATA GTTAATAATA ATTTATAATT CTGATTAGAT TTTTTTGTTA ATGCTATTAA AGGGGTGTGG AAAAAGTAAT AAATTTTATA 1891 TAAATAAATA TAATAAATTA AATTAAATTA TTAGTCAGAA ATGGATGCCA GCCGTTGCGG TAATTTCTAT GCTTTTAAAT ATTATACATT 1981 TATTTTATAA ATTTGTTACT GAATTAATTT TAGTCAATAA AAAAATATAT TTTTTTTATT TGTTTTTATA CACCATATGG TATATGCAAA 2071 TAAATAATGC TATTAATTAT TAATTATATT ATATTATATT TATTCATTTA AGTCGACAAT ATCTATTTAT TGTTTTTGAC AACATGATAA 2161 GGATTATAAA TGAAATTGTA AATTTTATAA TCAAAATTAA TTTATTATAT TAAATTAGCA TGTTTAGATA AAACAATAAA TTTAGAAGGT 2251 ATTGTTGCCC ACCATTCTTT GTAATAAAGA CAACGTGCAG TAATTAATAT ATTTATAAAA ATATATTTTT CCACATCAAA TCTTTATTAT 2341 TTTTTTTATT ATTTAGAACT TAATTAGTTT ATAATTTTAG TGTTTTTAAT AATTATATGT AAAAGAGAGT TTTTTCGGAA GGAGGGATTT 2431 TTCGGACCAG GAGAACCAGA GAGGTTTCGG GAATCAGCGA TTTTGATTGG GGGAACGGAG CCGTCGAGGA AATGCCCTAG AGCTTTAGAG 2521 CGGGAGAAGA GTTTTGGATC GACTGAAGAA AAGATCGTTT TCGGAAGGGG AGCAGGTCCA ACCTTTTGAT TTCTTTGCTA ATCACACAGG 2611 AGGGGGCCAG AAGTTTGCAT TTCCAAAGTA GTTTTTTGGG AGATTTTTTT TGAAGGGAAA AATTTTCGAG AAATTTTTAT GAGTTTGCTT 2701 TAACAATAAA AAAGAAATTT TAATTATCGA AAAACTTTTA AAAATAAAAT AAAAAATAAT TTTTTTGCAA ATTGAAATTT CCCAAAAAAT 2791 GCGGCTCCCT TCTTCCCCTC TAAATTTATT CCCAAATGGT TTTTCTCCCT CAAAAATCCT CGGTGTCTCT TCCCTCCCAA AATCCTAATC 2881 CGTTCAATCT CGCTCTCTCT CCCCTCTTTC CTTACTCGCT TTCTAAAACT AAATAATCTC GCCCCAAAAA CTCTTCTTCT TCTCTAGTCT 2971 TTTCTCAAAA CTCCCTTCAA AAAACTCTCC CTCAAATCTC TCCTCTCTTT TCAAAACCGA AAACTTAACA TCTTTTTTAT ATAGATTATA 3061 ATAAATTTAA ATGTTTGATA TAATTAAATA TTCTAAATTA TTTAATAATA TTAAAAATGA ATATTTTATT AAAATGATAT TAATATGTAT 3151 TATATTTAAT CATAATAAAA TTCCATTTAA ATTAAAGTAT ATTGTATTGT AAATATCAAT ACAGTGTAGA GTGTTAAAAA ATTTATTTAT 3241 TTTATTTAAA AAATAAAATT TCTTTTTATG TAATTTATAT GTAAACATTT TTAAATTTTA ATATAATTTA CAAAATTTAA GTTTAAAAAT 3331 ATTAAGAAAT ATTAACTTAT CAAAGCAGAC TACATGAAAA ATATAAAAAG GCACTTGTAT AGATTTACAT TTGGTCCACA ACATCCTGCA 3421 GCTCATGGTG TATTATGTTG TTTATTGTAT CTTTCAGGTG AGTTTATAAT GTATATAGAT GTTATTATAG GATATTTACA CCGTGGCACA 3511 GAAAAGTTAT GTGAATATAA AACAGTTGAA CAGTGTTTAC CGATGAAGAT TGGATTATGT TAGTGTTGTT TGTAATGAAC ATTTGTTGTC 3601 ATTATGTTTT GAATATATGT TACGATGCTG TTTAGCAATA CGTTGTGCAT TTATGCGTTT ATTGATGTGT GAATTTACAC GATGCTTTAA 3691 TGGCTTATTA TGTTGTTCTT GCATGGTTAT GGATATAGGA TCATTATCAC CTATGTTATG ATCATTTGAA GAGCGTGATA AATTAATGAC 3781 ATTTTTTGAT TTGTGTTGTG GTTGTAGAAT GCATTTAGCA TTTATGTGTT TATTAGGTTT ATTAGATGAT TTTGTATTTG GATTTGTTGA 3871 TTTTTTATTA ATGTTATGTA TTTCATGTTT ATTTGTATTA GATTTGTATG ATTTGCTTTT TATTGGAAAT AGATTTTTAT ATTTACGTTT 3961 GCGTGGACTT GCTTTTTTTG ATGTTTTTGA TTTATGCTTT AATAGTATTA GTGGTTGTTT ATCAAGATCA TTGGGTATGG TTTGAGATGT 4051 GAGATTATAT AGTAGTTATG AATTATATTT TATATTAGTG TTTGATTATT GTTTTTGTTA TTTAGGTGAT GCTTTTGACA GATTTTTTTT 4141 AAGACTTTTT GATATGCGTA TGAGTATACT TTTATGTAAA CAATGTTTTT TTATAGGTTT TTTTGTATTT GGATTTGTTT GTTTGTTTGA 4231 TTATATGTAT GTTGATATAA CAATAGAGAC AATTATAAGT TTATTTTATA GTTTATGATG TTGTATTTTA CCAGGTTGTT CATTTGCTAA 4321 TGTTGAACAT CCAAAAGGAG AGTATAGTAT ATTTTTATGT TTTTTATATG GATTTATATC AAGACTACGT ATTAGATGTG CAGACTTTAT 4411 ACATATTTGT TTATTAGATG TGATGATGCG AGGATTCATG ATTCATGATT TAGTTGCTGT TATTGGTAAT GTTGATGTTG TTTTTGGATC 4501 AGTTGATCGA TAGGAATTAA GTTTTTCAAA CTTTAAAAAA TAATTTTAAA TTTAAATTTA TTAAAAAGGG TTTTCCGGAA GGGGTGATTT 4591 TGTTTGTTTT TGTTTGGTCT ACTTTACCTG CTATCTGTAT TACATATTTA GCATTTTGTT TATGTAGTTT ATTTTGTATT ATGTTTAGTA 4681 GTTTTATATT TATTGATTAT TGTTTTATTT GTTTTTTTGC ATGTTTATTA TTTTGTTTAA TTTGTTTAAT ATGCGATTTA TTTGTTGATA 4771 CATTAAGAGG TTTATTTGAT ATATGTTGTT TAATTAGATG TATTCAATAT TGTTTTGTAT GATTTATATT AAGTGAATTA TTTCTTTTTT 4861 TATCGTTATT TTATGTTGTA TTTAGTTTAA TTTTATTTGT TAGTGTTGAA TTTGCTTTTA TATTTGTTAT TCCAATAATG TTTAGTTGTT 4951 TAATTTGTGA TTTTGGTTTT GTATTTTATT GATATTTTAT AGATGTTTTT AATTTATTAA TTAATACTTT TTTATTATTT GTAAGCGGAT 5041 TATTTATAAA TTTTGTTTTA TTTTTATTTT GATTACGTTT TTTTTTGTGT GTTTTATTTA TGTTATGAAT AGGAATTTTA TTTGGTTTTT 5131 TATTTTTATG AAATCAAGTT TGAGAGTTTT CTTTATTATT AGTAACATGT AGTTGTGGTA TATTTGGGTC AATACTTTTT TTAATTGATC 47

112 Universitas Scientiarum, 2011, Vol. 16 N 1: TTTTACATTT TAGTCACGTG TTTTTAGGTA TTTTTTTGTT ATTTATTTGC TTTAGCCGTT GCTTTAATTT TTTAAGTATG GATACACGTT 5311 TTGTTTTTTT ATATGTGGTA TGTTTATATT GACATTTTGT AGATTGTGTT TGATTTTTTT TATTACGGTT TGTATATTTT GATGTATTAA 5401 ATGTAGTGTA TTTATGTATA TAAAAAAGTA AGTATTTTTA CATATATTTA AAATTATAAG CGGAGAGAAA AGAAAAGGCT TAACTTCAGG 5491 TTGTTTATTG CGAATTTATG GTGTAGGTTT TAGTTTAGGT TTTTTTATTT GTATGCAAAT AATATGTGGT GTTTGTTTAG CATGATTATT 5581 TTTTAGTTGT TTTATTTGTA CTAATTGATA TTTTGTTTTA TTTTTGTGAG ATTTTGATTT AGGTTTTGTT ATAAGAAGTA CACATATTTG 5671 TTTTACATCA TTACTATTTT TTCTTCTTTA TGTTCATATA TTTAAAAGTA TAGTATTAAT AATATTATTT GATACTCATA TTTTAGTTTG 5761 AATTATAGGT TTTATTATTT ATATATTTAT AGTAATAATA GGTTTTATTG GTTATGTATT GCCATGTACA ATGATGTCGT ATTGAGGATT 5851 AACAGTTTTT AGTAATATTT TAGCTACTGT GCCAGTTATT GGTGTTTGAT TATGTTATTG AATTTGAGGA AGTGAATATA TAAATGATTT 5941 TACTTTACTT AAATTACATG TTTTACATGT TTTACTACCT TTTATTTTAT TAATAATAAT TTTTATGCAT TTATTTTGTT TACATTATTT 6031 TATGAGTTCT GATGGTTTTT GTGATAGATT TGCATTTTAT TGTGAGCGGC TATGTTTTTG TATGTGATTT TATTTAAGAG ATATGTTTTT 6121 AGCATTTTTA ATATTATTTT TTGTAGTGTA TTTTATATTT ATAAATTGAT ATTTTGTTTT TCATGAGGAG TCATGAGTAA TAGTAGACAC 6211 ATTAAAAACT TCTGATAAAA TTTTACCTGA ATGGTTTTTT TTATTTTTAT TTGGTTTTTT AAAAGCAGTA CCTGATAAAT TTACTGGTTT 6301 ATTATTAATG GTTATATTAT TATTTTCATT GTTTTTATTT ATATTAAATT GTATATTATG ATTTGTTTAT TGTCGAAGTT CGTTATTATG 6391 ATTTACTTAT TCATTAATTT TATTTTATAG TATATTTATG AGTGGCTTTT TAGCTTTATA CGTTATATTA GCTTATCCTA TTTGAATGGA 6481 GTTACAATTT TGAGTATTAA TTTTATTTAT GTTAATAGTA TGTAGATTAG ATTAG 2B Tamaño: 4257 pb. ADN circular DEFINICIÓN: ADN mitocondrial del maxicírculo pre-editado de Leishmania braziliensis. FUENTE: Mitocondria Leishmania braziliensis cepa MHOM-BR-75-M2904 CARACTERÍSTICAS: Localización G4 Cadena complementaria ( ) Región 4 rica en guanosinas ARNg Cadena complementaria ( ) ARN guía II para el ARNm del marco de lectura abierto MURF2 ND Gen de la sub-unidad 4 de la NADH deshidrogenasa; pre-editado ND3 Cadena complementaria ( ) Gen de la sub-unidad 4 de la NADH deshidrogenasa; pre-editado. También llamado G5 RPS12 Cadena complementaria ( ) Gen de la proteína ribosomal S12 ND Gen de la sub-unidad 5 de la NADH deshidrogenasa pre-editado gnd7 Cadena complementaria ( ) ARN guía I para el ARNm de la sub-unidad 7 de la NADH deshidrogenasa; gnd7-i ORIGEN 1 CAAAAATCAT TATAAGTCCA TGTGAAGTGA TTAAAACATT ATAAAATTGA TAGTCACCAA ATAAAATACC ACAACCAATA AGTGAAAGTT 91 CTAGTCTAAT AAATAAAGAA TATACATATC CAACAAAACC AGAAAGTATT GCAACTAAAA GATAACATAA ACCAATCATT TTATGAGATA 181 CACTTAAGCA AACGCACTGT AAAAACCACA TTAATATTAT ATTTAATTGT TAGTTATAAG TTTACAGCTT TTTCGCTCCC GTCTTTTTCC 271 CCTTCCTTCT GTTTTCTTCC CTCCACCTCT CTTCTCTCCC CTTCCTCCTT TTCCTCCTTT TCGAATTCCT TCTCTCTTTC CCTCAAACTA 361 TTCCTGCTTT TCCAAAAAGT CTCTCTCTTT TCCCCTTCTC TTCCTGTTTT ATTTACTTTA AAAAATTAAT ATAAAAATTA TTATTATTAA 451 TAAAAAACTC AGTCAAAATA TAAAAATAGA GTTAAATTAA AGTAATTAAA TAAATATTTT GTTTAAGTTT ATAATAATTA TATTAAATTT 541 TTTAATATTA TTTTTAGTAA TACTTTTTAT ATTTATAAAT TATAGTTTTT GTTTAGTATT TAAATTTAAT TATATTTATA TAAATATATA 631 TTTAAATTAT ATTAATTTAT GATTTATATT TTTTATGGGA TTAATAGTGT ATTTTCTTGT TTTTCTTTTA TCACGTAAAA TTATTTCATA 721 TAATAAGTAT TTTTATGTTT TATGTTCATA TTTATTTATT TATTTAGATG TTGTATTAAT TATTCTAATT GATGATTTTA TGTGTTTTAT 811 GATATTATTT GAAAGTTTAT TTTTTCCAAT TTGTTTTGTT AGTTTATTTT TTAATTTCAA TAATAGATTT ATTTTTGCTA TATTTTATTT 901 GATAATATTT AGTTCTTTAA GTTCGATAAT GTGTATTATG ATTTGTATAA TTACTTATAT TTCATTTTAA TATATTAAAT TTACAAAGTT 991 TTATAGATAT TTGTATTTTT GATAGTTTAT ATTTAGGTAT GTATATATGA ATTTTATTAT TTATAATGTT TGCAATAAAA TATCCAATTT 48 Nocua et al

113 Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis 1081 GACCATTACA TGTATGACTT CCTGAAATGC ATGTAGAAGT TAATACTGAA ATGAGTGTAT TATTAGCCAG TATAGTTTTA AAAATTGGTT 1171 TTTTTGGAAT ATATAAATTT TTATTTGTAT GTTTTAGCCA ACTTTCAATC TGATTTTTAG GTTTTATTGA TTCATTAATT ATGTTAGGAT 1261 TAACTTTTTT AGCATTAACA TTATTGTTTT TAAGTGATTA TAAAAAAATT ATTGCAAACT GATCAGTAAT ACATACAGGA ATCGCATTGA 1351 TATTGTTATG ACATAATGAT ATTCTTTTTA TAGGTATACT TATATTATGT AATTTATCTC ATATTATTAG TTCATCTTTT ATGTTTATTT 1441 TAGTAGGCTA TATGTATGAC AATTATGGTG TACGTATATT TTTATTAATG ATTTCTTTTT TTGGTATAAG TGTATGAAGT TCGTTATTTT 1531 TAGGTTTATT TTTATTTAAT ATAGATTTCC CATTTATGAT ATTATTTTAT GTAGATATAT TTTTGTTATA TGGTTTAATT TCATTATCAT 1621 TTATTTATAT TTTTTGTTTT TATATAATAG TGTTATCAAT TTTTTTATCT TCAATATATA TATATATATG TTTAAGTTTT TATTCGTTCA 1711 TATGAATAGA TAAATATTTA CGTTTAGATT TATCAATTAA TGATATATAT TTATATTTTA TAACTATTTT AATGGTTACT TTATTTTTTT 1801 ATTTAATTTA TTTATTATTT TAAAGTTTGA ATTGAATATT ATTTTTATTT TCCAAGTACC AGTCTTTTAC AAATCCCTTT TCCCTTTTCT 1891 TTCCCTCCCT CTTCCTTAAA GATTTCCTTC CGCGAAACTT CTTAAGTAAC TCCGTGTTCT TCTTCCCTGT CCCACCGCTC TGCCCTTCTT 1981 CCCTTTTTTC CAACTAAATC CTAAATTGAA CCATTTATTA AGTTTAAAAC GTTTTGAATT TTTGAGGAGT ACTGATTAGG AAAAGCCACG 2071 AACCAAGCTC CGGAACCGAC GGAATTTGCA AAGAAGAAAA GAGAGATTGT GCTTTTTTGG GGACAACAAT TTGAAGGAAT TTTTTGGGGG 2161 GAGATTTGCC AGGAGAAAGA TTCACGGAAT TTTTTGTTTC GTAAGCTTGT TTATTAAAAA AATTATACAA TAAAGATTTG AATATAAAAT 2251 TTGTTTTTAT TTTTTTTTAT TTTATTTTCT ATATTTGGAC TTATATGTGG TATATTTATT TTAGGAAGGC ATATAATAAG TTTCTGATTA 2341 TCAATAGTGT TATCTATATC ATTGGTATTA TCTACAATAT TTAGTTGCTT TTGTTTAAGT GTCTGTATAT ATGGTTATTA TTTTTATGAT 2431 TTTTGTTTAT TAATAATTTT AGATTTTTGT TTTATTTGAT TGACATTTTA TTGTAATGGA TTTTATATGT TTATATTGTT TTTAATAGAT 2521 ATAGTTTTTT GTTTTATAAA TTTTTATGCA TTTTATTATA TGTATTTTGA TATAATGTTA ACTAGGTTTT TTAATATTTT TTGGTGAATT 2611 GTGTTGTGTA TGAATTTTTT TATATTATCA TATGATTTTT TAACAGCATA CTGTGGTTGA GAATTATTAG GTTTATTTTC ATTTTTTTTA 2701 ATATCATATT TTTGATATAG ATTTTTTTCA TTGAAATATG CATTTAAAGC ATTTTTTATT AGTAAAATAG GGGATATTTT GTTACTTTTA 2791 TCATTTGTTT TGATTTTTTC AATAAATGGG TATTGTGTAA TAACATTTTA TTTTTTATCT TTTTTATGTG TTGATTATAG TGTAATTATT 2881 TTTGCAATGC TTTTATTAAT GATTTGTGCG TTTACTAAGT CCACTCAATT TGGATTACAT ATTTGGTTAC CAGATGCAAT GGAAGGACCG 2971 ATTCCTGTTT CGGCATTAAT ACATGCAGCT ACGTTGGTAG TTTGTGGTAT ATTATTGATT AGTTTTGTTT TTTGATGTTT TGACTTTTGA 3061 TTGTGTTATT TTTATACTGT AATAGGATGA ACTAGCTTAA TTTTAGTAAT GATGAGTTTA TGTGTGTTTT ATAATTTTGA TGTAAAAAGA 3151 TTTGTTGCAT TTAGTACTAT ATGTCAAATT AGTTTTTCTA TGTTTTGTTG TTTATGTTTA GATTTATATG TAGGTTGTTT AATATTTTGT 3241 TATCATATGT TTTATAAAGC AACATTATTT ATAGTTTTTG GAGTTTGAAT TCATTTTTTT TTTGGGTTAC AAGATATAAG ATGTTATTTT 3331 TTTACTTATT TTTGTGGTTG TATTTTAGCA AGAATGTTAT TGGTATTTGC ATTATTAAAT TCATGTTCAT TATGATTTTT ATGTGGTTTT 3421 TATTGTAAAG ATCTTTTATT ATGTGTATTA ATGTTAGTAT CTTTTTTTTT TATATTAGAA TTTTTGTGTG TTTGTATATT TTTTATATTT 3511 TTTACTATAG TATATAATTA TTTTTTACTT TTTTTTTTGT GTTTTGTTTT TAAATGTTTT TGTTTAGTAG ATACTTTATT TTTAATTTTT 3601 GATTTTGAGT GTTGTTTAAT TTATTGTATA TGTTGTTTAT ATATGTGTTT TATAATGCTA TTTTTTGTTT TAGATTTTTT ATATGTATTT 3691 ATATTTACAA GTTATTGTTT ATTTTGATCA TTTTATTTAT ATTATTTTTC ATTTTTTGAT ATAGCGATAT TTATTACTTT TATAATGTTA 3781 TTATTGAGTT TTATATATTA TGGTTGATTT ATATTTTATT TTTTTAATGT TGATTGTATT ATGTTTTTTT GAAGAATATT TTTAATTTTT 3871 ATGATGGCTT TAGTATTTAG TTTATTTTCA ATATGATATT TTACGTGTTT TTATTCGGAT AGGTTTTTAT GGGTATGAGA TAGGGTTATA 3961 TATATGAGAT ATAGGAACAA GTATTGTGTA TTTTGCAGCG TGTTACTATT GTGATACATG TAAAGAAAAT TTTAAGTTGA ATGTATATAA 4051 TTAATTGGTC CTGTCTATTA GAAGTATAAA AAGTAAAAGA AGTTTGATAT TATTTGAAAA TTTATATTAT CTAGTAACTT CAGGTGTGAT 4141 TGTCAAATTT ATTTTGAAAT GAATGCGGTT ATATGTAAAA TACATAAGAA TTTATTTAAA ATAAAAATTC CAAATCTAAA ATAACAGAAA 4231 ATGATATGAA AAATAAAATA GATATTA Material Suplementario 2. Descripción de la secuencia parcial reportada para la región del maxicírculo ensamblado de L. braziliensis. A. Secuencia correspondiente al fragmento ensamblado de 6535 nts. En color se señalan los fragmentos utilizados para la construcción de la secuencia, se ubican desde la posición 1 de la secuencia hacia abajo: brazil241b09.p1k, brazil226a12.p1k, brazil66e05. q1k, brazil1521b09.p1k, brazil595d07.p1k, brazil1 252c02.q1k, brazil700a03.p1k, brazil802h07.q1k, brazil487c05.p1k, brazil982e01.p1k RevComp, brazil 81e11.p1ka, brazil251e11.p1k, brazil1081f06.p1k, brazil653a10.p1k, brazil27a07.q1k RevComp, brazil 423g06.q1k RevComp, brazil20h04.p1k, brazil1133b07. p1k RevComp, brazil1348c08.q1k RevComp, brazil 281b06.p1k RevComp, brazil606f10.p1k RevComp, brazil466g05.q1k RevComp, brazil621f05.p1k RevComp, brazil1598g08.q1k RevComp, brazil555h03.p1k Rev Comp, brazil227d04.p1k RevComp, brazil81e11.q1ka RevComp, brazil182d06.q1k RevComp, brazil1432f10. q1k RevComp, brazil63b03.p1k RevComp, brazil 49

114 Universitas Scientiarum, 2011, Vol. 16 N 1: c12.q1k RevComp y AB RevComp. B. Secuencia correspondiente al fragmento ensamblado de 4257 nts, En color se señalan los fragmentos utilizados para la construcción de la secuencia, se ubican desde la posición 1 hacia abajo: brazil655c08.q1k, brazil483f03.q1k, brazil 622d11.p1k RevComp, brazil655c08.p1k RevComp, brazil483f03.p1k RevComp, brazil484c11.q1k, brazil 827b08.p1k RevComp, brazil1043b09.p1k, brazil 1043b09.q1k RevComp, brazil1001a09.p1k RevComp, brazil1501c12.q1k RevComp, brazil1501c09.q1k RevComp. 50 Nocua et al

115 MATERIALES, MÉTODOS Y RESULTADOS 7.4 Artículo No. 4 Evidence of RNA editing in Leishmania braziliensis promastigotes 115

116 Parasitol Res DOI /s ORIGINAL PAPER Evidence of RNA editing in Leishmania braziliensis promastigotes César Ramírez & Concepción Puerta & Jose M. Requena Received: 14 August 2010 / Accepted: 6 October 2010 # Springer-Verlag 2010 Abstract RNA editing in trypanosomatids is an elaborate form of post-transcriptional processing that inserts and deletes uridines in many mitochondrial pre-mrnas, providing the genetic information needed to create functional transcripts. The process has been extensively analyzed in Trypanosoma brucei, Crithidia fasciculata, and Leishmania tarentolae. However, few data exist on this mechanism in pathogenic Leishmania species. Here, we show evidence that this process also operates in Leishmania braziliensis, being the first time that RNA editing has been described in a species of the Viannia subgenus. A partially edited transcript corresponding to the NADH dehydrogenase subunit 8 (ND8) gene was identified in L. braziliensis promastigotes. Sequence analysis allowed the identification of the maxicircle-encoded cryptogene, which shows a high degree of sequence conservation with the corresponding cryptogenes in other Leishmania species. Although an edition pattern could be postulated for the ND8 transcripts in L. braziliensis, attempts to isolate completely edited transcripts by RT-PCR were not fruitful; instead, many transcripts with partial and unexpected editing patterns were isolated. This data, together with our inability to Electronic supplementary material The online version of this article (doi: /s ) contains supplementary material, which is available to authorized users. C. Ramírez : C. Puerta Laboratorio de Parasitología Molecular, Departamento de Microbiología, Pontificia Universidad Javeriana, Bogotá, Colombia C. Ramírez : J. M. Requena (*) Centro de Biología Molecular Severo Ochoa (CSIC-UAM), Universidad Autónoma de Madrid, c/ Nicolás Cabrera 1, Madrid, Spain jmrequena@cbm.uam.es detect full-size transcripts by Northern blotting in promastigotes of L. braziliensis, led us to the suggestion that the strain used in this study (M2904) lacks of critical RNA guides for a complete edition of ND8 transcripts. Introduction Protozoan parasites of the genera Leishmania are causative agents of a group of diseases, known as leishmaniases. These range from the spontaneously healing cutaneous lesions arising from Leishmania major infection to mucocutaneous leishmaniasis usually associated with Leishmania braziliensis and the often fatal visceralising disease, caused by Leishmania donovani, in the Indian sub-continent, and Leishmania infantum (Leishmania chagasi), in Latin America and the Mediterranean basin (Bañuls et al. 2007). World Health Organization (WHO) epidemiological data indicate that there are over two million new cases of leishmaniasis each year in 88 countries, with 367 million people at risk ( leishmaniasis.htm). Leishmania parasites undergo a digenetic life cycle, differentiating from the promastigote form in the insect vector, the phlebotomine sand fly, to the amastigote form in the lysosomal compartment of the macrophages of mammals. Leishmania, and related trypanosomatids of the genera Trypanosoma, derive from one of the earlier evolutionary lines diverging from the common trunk of eukaryotes (Moreira et al. 2004). As a reflection of their evolutionary distance to most of eukaryotes, they possess several distinctive features and surprising molecular mechanisms (Donelson et al. 1999). Perhaps one of the most fascinating molecular mechanisms operating in these organisms is RNA editing of their mitochondrial transcripts (Estevez and

117 Parasitol Res Simpson 1999). RNA editing is a unique post-transcriptional RNA maturation process that in trypanosomatids involves the addition or removal of uridine (U) residues at precise sites of mitochondrial transcripts. This process creates initiation and termination codon, corrects frameshifts, and builds entire open-reading frames from nonsense DNA sequences. The mitochondrial genome of trypanosomatids is also peculiar; it consists of a network of two classes of topologically interlocked circular DNA molecules: maxicircles and minicircles (Schneider 2001; Lukes et al. 2005). There exist about 50 copies of the maxicircle DNA (20 40 kb in size, depending on the species), they are similar in composition and contain the complement of genes typically found in the mitochondrial genomes. Minicircles are smaller molecules ( kb), heterogeneous in sequence, that are found in 5,000 10,000 copies per organelle. Some of the maxicircle genes (termed cryptogenes) encode transcripts that need to be remodeled by RNA editing in order to convert them into translatable mrnas. The genetic information dictating RNA editing of particular transcripts is specified by short transcripts called guide RNAs (grnas), most of them encoded in the minicircle DNAs (Arts and Benne 1996). The first description of RNA editing was provided by Benne et al. (1986) and was based on the finding of a major transcript of the cytochrome oxidase subunit II (coxii) containing four nucleotides non-encoded in the DNA and that corrected the frameshift in the Trypanosoma brucei coxii gene. Soon thereafter, additional examples of RNA editing were reported in T. brucei and in two other trypanosomatids, the saurian parasite Leishmania tarentolae and the insect parasite Crithidia fasciculata, which became model organisms for studying RNA editing (Arts and Benne 1996; Simpson and Shaw 1989). Twelve of the 17 pre-mrnas encoded in the mitochondrial genomes of these trypanosomatids were shown to be edited (Stuart et al. 1997). Some pre-mrnas are extensively edited (pan-edited) and this remodeling may affect more than 50% of the final sequence. However, the extent of editing within a given gene may be different between species (Seiwert 1995; Simpson et al. 2000). Another remarkable feature is the co-existence in the mitochondrial steadystate RNA population of completely unedited, partially edited, and completely edited forms for each gene transcript (Simpson and Shaw 1989). RNA editing is believed to proceed in the 3 to 5 direction; however, partially edited RNAs with aberrant patterns of editing are frequently observed at the transition of unedited to edited sequences, in which editing sites contain wrong number of Us, non-edited sites are edited, and 5 sites are edited before complete editing of 3 sites. The frequency of this class of aberrant transcripts is both transcript and species dependent (Benne 1994). Apart from T. brucei, L. tarentolae, and C. fasciculata, in which the mitochondrial RNA editing has been studied extensively, there are few reports of editing in other species of the class Kinetoplastea (Simpson et al. 2000). Until recently, mammalian-infecting Leishmania species were not analyzed for the presence of RNA editing. Ibrahim and co-workers (Ibrahim et al. 2008) described that L. donovani coxii gene is edited in an identical manner as the homologous gene in L. tarentolae. Recently, a more complete picture of the RNA editing process in this species has been reported (Nebohacova et al. 2009). In L. major, after analysis of the maxicircle sequence and its comparison with the L. tarentolae maxicircle sequence, it has been suggested that the RNA editing process should be equivalent to that described in L. tarentolae (Yatawara et al. 2008). More recently, a study on the editing process in Leishmania mexicana amazonensis has been published (Maslov 2010). However, no data have yet been reported on the existence of RNA editing in any Leishmania species of the subgenus Viannia. Thus, this study provides the first experimental evidence of active RNA editing in L. braziliensis, a species of the subgenus Viannia, which cause cutaneous and mucocutaneous leishmaniasis in Latin America (Martinez et al. 2010). Materials and methods Parasites Promastigotes of L. braziliensis (MHOM/BR/75/M2904) were grown at 26 C in Schneider's medium supplemented with 20% heat-inactivated fetal calf serum and 100 ng/ml of 6-biopterin (Sigma Aldrich). This strain was provided by the Centro Internacional de Entrenamiento e Investigaciones Médicas (Cali, Colombia). RNA extraction and RT-PCR Total cell RNA was isolated from L. braziliensis promastigotes using Total Quick RNA extraction kit (Talent, Italy). First strand of cdna synthesis was carried out on L. braziliensis total RNA using oligo-dt primer and a cdna synthesis kit (Pharmacia LKB). Amplification of edited transcripts was performed by RT-PCR on poly(t)-primed cdna using specific primers: LbND8-D, 5 -TTTTA GTGTT TTTAA TAATT ATATG-3 ; and LbND8-R, 5 - TACTC GTATA ATAAT TAAAC AAAAC-3. RT-PCR products were separated on agarose gels, visualized under UV transilluminator and purified using the Favorgen gel purification kit (Biotech Corp., Taiwan). Finally, the amplification product was cloned into the pcr2.1 T-vector (Invitrogen).

118 Parasitol Res Sequence analysis Sequences were determined using the Big Dye Terminators v3.1 kit (Applied Biosystem) by automatic sequencing at the Servicio de Genómica (Parque Tecnológico de Madrid, Universidad Autónoma de Madrid). Sequence of clone 600 D has been deposited in the European Nucleotide Archive (EMBL-EBI) with the accession number FR Sequence analyses were performed using the BioEdit program (Hall 1999). Maxicircle DNA sequences were obtained from the L. braziliensis database at GeneDB ( The assembled sequence used in this study (see Supplementary material) was derived from the following shotgun reads: brazil20h04.q1k, brazil27a07.q1k, brazil81e11.p1k, and brazil802h07.q1k. Northern blot analysis L. braziliensis total RNA (4 μg) was fractionated by electrophoresis in formaldehyde (6%)-agarose (1.5%) gel as previously described (Folgueira and Requena 2007). After electrophoresis, gels were blotted onto positively charged Nylon membranes (Roche Diagnostics, Germany). The filters were hybridized with the 600D probe (see below), which was labeled with digoxigenin-dutp using the DIG High Prime DNA Labeling Kit (Roche). Results and discussion In the process of cloning the 3 -UTRs of L. braziliensis HSP70 genes, we isolated a cdna clone (named 600D) containing a sequence that did not correspond to the searched regions. An analysis for sequence homology in the L. braziliensis database (GeneDB) yielded no results when the 600D sequence was compared with either predicted genes or chromosome contigs, pointing to a cloning artifact. However, when a BLAST search against L. braziliensis unassembled shotgun reads was performed, a disconcerting result was obtained. Of the 349 nucleotides composing the 600D cdna sequence, only the first 155 nucleotides were found to be present (100% identical) in a large number of unassembled entries. However, none of the database entries showed significant homology with the rest of the sequence. An important clue about the nature of this cdna clone was obtained after searching in the GenBank database: the sequence gave a high score of homology with the FJ entry, which contains a partial sequence of the L. donovani maxicircle (Nebohacova et al. 2009). Again, the homology was restricted to the 5 -end of the 600D sequence. This finding prompted us to analyze whether the clone 600D might be a cdna copy of an edited transcript from the L. braziliensis mitochondria. Since the existence of RNA editing in L. braziliensis had not been documented until now, we considered of interest to analyze further the clone. Thus far, within the Leishmania genus, experimental demonstration of active RNA editing of mitochondrial transcripts has been obtained for L. tarentolae (Simpson and Shaw 1989) L. donovani (Ibrahim et al. 2008) and L. m. amazonensis (Maslov 2010). In order to check the hypothesis that the 600D cdna might represent an edited transcript, we searched in the L. braziliensis database for the putative cryptogene. A nt-long sequence, centered on the 155 conserved nucleotides of the 600D clone, was assembled from shotgun reads found in the L. braziliensis database (see Supplementary material). Afterwards, a manual alignment between the 600D sequence and the assembled region was carried out considering the fact that the GAC-sequences of both cryptogene and cdna must be identical, since RNA editing affects only the U residues. As shown in Fig. 1, a perfect co-linearity was found between both sequences, suggesting that indeed the clone 600D was derived from an edited transcript. Moreover, the edition was found to be extensive in the edited region of transcript 600D (from nucleotide 156 to 301; Fig. 1). The editing entails addition of 81 uridines and removal of 20 uridines at 40 total sites, resulting in an edited region that is 52% larger than the pre-edited region. These data suggested that the 600D transcript was a result of massive editing, comparable to extreme cases of editing such as those affecting to COIII (Feagin et al. 1988) and MURF3 transcripts (Koslowsky et al. 1990) of T. brucei. The 600D cdna ended with a non-encoded poly(a) tail, a typical characteristic of mitochondrial mrnas in trypanosomatids (Van der Spek et al. 1990). Another typical feature of maxicircle genes encoding extensively edited mrnas is the existence of a guanidine (G) versus cystine (C) strand bias, and the coding sequence located invariably in the G- rich strand (Stuart 1991). This bias exists also in the 600D cdna sequence, which has a G% C% value of In order to identify whether a protein is encoded in the 600D cdna, we analyzed possible ORFs. The results were rather disappointing, since stop codons were observed in all three frames. Thus, we assumed that the 600D cdna might correspond to a partial edited transcript, and searches against the UniProtKB database ( were carried out using the amino acid sequences deduced in the three frames. Remarkably, short stretches from frames 1 and 3 yielded significant sequence homology with the Q7M3U1 entry, which corresponds to the NADH dehydrogenase subunit 8 (ND8,G1) of L. tarentolae. In this species, the protein is encoded by the G1 cryptogene that needs to be extensively edited to yield a translatable mrna (Gao et al. 2001; Thiemannetal.1994). Similarly, in T. brucei, the homologous cryptogene, named CR1, is edited by the addition of 259 uridines and the removal of 46 uridines

119 Parasitol Res Fig. 1 Editing pattern of the 600D cdna deduced from the alignment between the 600D cdna and L. braziliensis maxicircle DNA sequence (LbMax). Edited positions (due to uridine insertions) in the 600D sequence are shaded in green. Positions in the genomic sequences, removed during editing (uridine deletions), are shaded in red (Souza et al. 1992). In both species, only short stretches at both ends of the ND8 transcripts are not edited. However, despite these tremendous editions, the final amino acid sequences are highly conserved (Thiemann et al. 1994). Assuming that the 600D cdna was probably an editing intermediate of the ND8 transcript, we analyzed sequence conservation between L. tarentolae G1cryptogene and the putative homologous region in L. braziliensis. In addition, we included in the comparison analysis the sequences for Fig. 2 Alignment of the ND8 cryptogene of L. tarentolae (LtND8c; (Thiemann et al. 1994)), DNA sequence for L. braziliensis maxicircle (LbMax; this work), L. donovani ND8 cryptogene (LdND8c; positions from the GenBank entry with accession number FJ416603), and L. amazonensis ND8 cryptogene (LaND8c; Maslov 2010). Nucleotide positions with sequence conservation greater than or equal to 75% are shaded. Dashes denote gaps introduced to maximize alignment. The nucleotides that form part of the initiation and termination codons, which are created by editing, are underlined

120 Parasitol Res this cryptogen in L. donovani (Nebohacova et al. 2009) and L. amazonensis (Maslov 2010), which have been recently determined. Figure 2 shows the alignment of ND8 cryptogenes from these four Leishmania species, evidencing remarkable sequence conservation, which suggests both a selective pressure to maintain the DNA sequence and, probably, a functional importance for these cryptogenes. This high sequence conservation prompted us to deduce a theoretical edited transcript for L. braziliensis ND8 based on the edited ND8 transcript sequence in L. tarentolae (Gao et al. 2001). As shown in Fig. 3, it was possible to deduce a hypothetical edition pattern that fits perfectly to the cryptogene sequence and, more importantly, codes for an amino acid sequence sharing 93% of identity (97% of similarity) with the ND8 protein from other Leishmania species (Fig. 4). This analysis showed the existence of a probable frameshift (denoted by + in Fig. 3) in the edited region of the 600D cdna, suggesting that a misedition took place in the original transcript. RNA editing intermediates with unexpected patterns of editing in which uridines are inserted at sites not normally edited are frequently observed (Sturm and Simpson 1990). Another noticeable finding of the deduced ND8 sequence, also occurring in the L. tarentolae sequence, is that the tryptophan residue is coded by the UGA stop codon. Reassignation of the UGA codon to tryptophan occurs in many mitochondria including the ones from trypanosomatids (Schneider 2001). In summary, these data suggest that ND8 transcript in L. braziliensis needs to be Fig. 3 Editing of L. braziliensis ND8 mrna (LbND8h) and comparison with the homologous transcript of L. tarentolae (LtND8). The sequence for the L. braziliensis ND8 cryptogene (LbMax) is also shown. Genomically encoded nucleotides are shown in upper case, inserted uridines with lower case (u), and deleted residues are indicated with asterisks. Experimentally deduced editing events, according to the 600D cdna, are shaded in green, whereas those inferred by sequence comparison with LtND8 transcript (Gao et al. 2001; Thiemann et al. 1994) are shaded in yellow. Gaps (shown with dashes) were introduced to maximize alignment. The initiation (AuG) and the stop (uaa) of the L. braziliensis ND8 transcript, created by editing, are indicated in bold. The predicted amino acid sequence for L. braziliensis ND8 (LbND8p) is also shown. A putative mis-edited position in the 600D cdna sequence is denoted by plus sign, +. The position of the oligonucleotides, designed for RT-PCR amplification of edited ND8 mrnas, is shown by underlining in the LbND8h sequence

121 Parasitol Res Fig. 4 Alignment of the predicted amino acid sequences of ND8 proteins from T. brucei (TbND8; GenBank accesión number AAA91499), L. tarentolae (LtND8; (Thiemann et al. 1994)), L. braziliensis (LbND8), and L. amazonensis (Maslov 2010). Amino acid positions with sequence conservation greater than or equal to 75% are shaded pan-edited to become a functional mrna and the 600D cdna represents only a partial, misedited intermediate. Based on the edition pattern deduced for the L. braziliensis ND8 transcript (Fig. 3), we designed a forward oligonucleotide (5 TTTTA GTGTT TTTAA TAATT ATATG 3 ), located in the 5 -end, non-edited sequence of the cryptogene, and a reverse oligonucleotide (5 TACTC GTATA ATAAT TAAAC AAAAC 3 ), located in the edited region of the 600D cdna. These oligonucleotides, and oligo(dt)-primed cdna from L. braziliensis, were used to specifically PCR-amplify edited ND8 sequences. After cloning of the RT-PCR product, ten cdna clones were analyzed by restriction analysis. The inserts Fig. 5 Alignment of cdna sequences derived from partially edited L. braziliensis ND8 transcripts. In the sequence of the clone 600D, nucleotides expected to be deleted during editing are shaded in blue, those added during editing are shaded in green, and a misedited nucleotide present in the cdna 600D is shaded in red. In the sequence of clone Cl-F, an adenine seems to have been deleted during editing (position shaded in yellow). The position of the oligonucleotides, designed for RT-PCR amplification of edited ND8 mrnas, is shown by underlining in the sequence of clone Cl-B

122 Parasitol Res of the clones had a size lower than the expected for the completely edited RNA, which would be around 550 nt (Fig. 3). Four of them (clones B, C, F, and H) were sequenced (Fig. 5). As expected from their insert size, all clones correspond to partial edited intermediates. The extent of edition found in these clones was lower than that observed in the clone 600 D. Nevertheless, the 3 -ends of the sequences showed an edition pattern identical to that found in clone 600 D; however, in upstream regions, the sequences were either unedited or misedited. The existence of unexpected editing patterns, which are inconsistent with strictly progressive 3 to 5 editing has been previously documented (Sturm et al. 1992; Sturm and Simpson 1990). In two of the clones (F and H; Fig. 5), the uridine predicted to be misedited in the 600D transcript (Fig. 3; see above), was missing. This finding reinforced the conclusion that this uridine residue was misadded by the editing process in the 600D transcript. Since all ND8-derived cdna clones had a different sequence and, more importantly, they contained many miseditions, it can be postulated that incomplete editing intermediates must be abundantly generated during the editing process of the ND8 transcript in L. braziliensis; it is likely that the editing of this transcript is very prone to error. Abundant, imprecisely edited transcripts have been found in the editing process of many trypanosomatid mitochondrial RNAs (Decker and Sollner-Webb 1990). In fact, partially edited mrnas are substantially more abundant than mature mrnas for extensively edited transcripts (Koslowsky et al. 1991). Remarkably, for all the ND8-derived cdnas (Fig. 5), the 3 portion was identical and correctly edited, the central region was partially edited (and misedited in some positions) and the 5 portion was unedited. These features suggest the existence of several editing domains in the L. braziliensis ND8 transcript; additionally, these findings are consistent with a 3 to 5 global direction of the editing. However, within a given domain (i.e., the central region of ND8 cdnas), editing appeared to be both indiscriminate and disorganized. Thus, in this region, there are incompletely edited sites that contain either too many or too few uridines relative to the edited sequences. Furthermore, some sites were found to be incompletely edited in more than one way in different clones, suggesting that there is no single way to edit a site during the editing process. For example, clone Cl-B (Fig. 5) contained an insertion of 11 uridines in a site where only one uridine must be inserted. Also, this clone contained insertions at sites where edition is not expected to occur. Perhaps more striking was the observation that an encoded adenine, present in the cryptogene, seems to have been deleted during editing process, as deduced from the sequence of the Cl-F cdna (Fig. 5). However, clones displaying unexpected patterns in which purine residues are deleted have been found in partially edited mrnas for cytochrome b and subunit III of cytochrome oxidase in L. tarentolae (Sturm and Simpson 1990). In summary, our observations suggest that the editing process, at least for the central domains of the ND8 transcript, is quite indiscriminate, adding and deleting variable numbers of uridines at many sites, and that the editing in these central domains does not progress in a strictly consecutive 3 to 5 direction. Since it was not obtained evidence of complete edition of the ND8 transcripts in L. braziliensis by RT-PCR amplification, we carried out a Northern blot analysis using the insert of clone 600D as probe (Fig. 6). RNA samples were obtained from promastigotes growing either at the logarithmic or stationary phase; also RNA samples were obtained from promastigotes submitted to heat shock treatment. In all lanes, a hybridization band of about kb was observed, but transcripts with higher size, accounting for a complete edited transcript, were not found. In summary, our data suggest that ND8 transcripts in L. braziliensis (MHOM/BR/75/M2904) promastigotes are mostly edited in a partial manner. This strain, chosen for L. braziliensis genome sequencing (Laurentino et al. 2004; Peacock et al. 2007), has been propagated axenically for long time (in our hands during the last two years) and probably it has experienced a loss of critical grnas needed to achieve a complete editing of ND8 transcript. Apparently, in cultured trypanosomes, the NADH dehydrogenase complex is not ND8 rrna Fig. 6 Northern blot analysis of ND8 transcripts in L. braziliensis promastigotes. Four micrograms of total RNA from promastigotes growth at 26 C (lane 1) or incubated for 1 h at 32 C (lane 2), 35 C (lane 3), or 37 C (lane 4), and from promastigotes at the stationary phase of growth (lane 5) were electrophoresed as described in Materials and methods. The insert of 600D clone was used as probe. As load control, the ethidium bromide-stained agarose gel is shown (bottom panel)

123 Parasitol Res functional and not used for energy production (Benne 1994). Disruption of RNA editing by prolonged cell culture has been documented in L. tarentolae (Thiemann et al. 1994) and L. donovani (Nebohacova et al. 2009). In L. tarentolae, species in which this phenomenon has been studied more extensively, transcripts of the G1 G5 cryptogenes are panedited in a recently isolated strain (LEM125), but not in the UC strain which has been axenically cultured for many years. At least 32 minicircle-encoded grnas, present in LEM125, were found to be absent in UC strain (Thiemann et al. 1994). The L. tarentolae G1 transcript is the homologous to the L. braziliensis ND8 transcript, reported in this work. As shown in Fig. 2, both cryptogenes are highly conserved, suggesting that similar edition pattern must occur to obtain the mature ND8 mrna. In fact, the RNA edition of G1/ ND8 transcripts, experimentally demonstrated, is highly conserved in both species (Fig. 3) and yields nearly identical amino acid sequences for the deduced proteins (Fig. 4). The complete edition of G1 transcript in L. tarentolae requires the sequential use of 13 grnas (Gao et al. 2001; Thiemann et al. 1994). The edition of the partially edited ND8 in the 600D cdna would need of the use of grnas equivalent to L. tarentolae gnd8-i, -II, -III, and -IV RNA guides. Therefore, it is likely that the gnd8-v homologous in L. braziliensis strain M2904 is missing, hindering the correct progression of editing machinery, and resulting in an accumulation of incomplete and aberrant editing intermediates (Fig. 5). In a recent work, Nebohacova et al. (2009) indicated that only pre-edited and minimally edited ND8 transcripts are detected in cultured promastigotes and amastigotes of L. donovani. Thus, it is likely that the incomplete editing of the ND8 transcripts found in the L. braziliensis strain used in this work may be the result of a gradual loss of minicircles harboring the necessary grna genes during the cultivation of this parasite under laboratory conditions. However, a recent report on the edition process in L. amazonensis (strain LV78) has shown that the investigated strain has preserved its full editing capacity in spice of the long-term maintenance in culture (Maslov 2010). In fact, a complete edition of ND8 transcript was found to take place in this strain. This new finding suggest that some important, yet not fully appreciated, biochemical differences among the strains or species play an important role in maintaining intactness of the editing system or allowing for its loss in some cases (Maslov 2010). Concluding statements Data presented in this paper show that RNA editing also occur in L. braziliensis, a species of the Viannia subgenus, in which this mechanism has not been formally documented yet before. In addition, our data suggest that RNA editing in this species may be a labile genetic trait. However, to verify whether grna loss did occur in L. braziliensis strain M2904, a complete characterization of both maxicircle and minicircle sequences needs to be done, and a comparison with those of recent isolates of this species should be carried out. Furthermore, determination of possible differences in RNA editing between promastigotes and amastigotes, using serial analysis of gene expression (Ouakad et al. 2007; Li et al. 2008), would help to deciphering the actual importance of this process in Leishmania. This is likewise the emphasis in the next stage of our research. Acknowledgements Genome sequence data from the Sanger Institute sequencing projects (GeneDB) were invaluable for this work and their provision in the public domain is gratefully acknowledged. This work was funded by grants from the Ministerio de Ciencia e Innovación (BFU ), the Spanish Ministry of Science and Innovation and the Instituto de Salud Carlos III within the Network of Tropical Diseases Research (RICET RD06/0021/ FEDER) to JMR, and the Colciencias Research project No to CP. CR is the recipient of a predoctoral fellowship from Colciencias (Colombia). Also, an institutional grant from Fundación Ramón Areces is acknowledged. References Arts GJ, Benne R (1996) Mechanism and evolution of RNA editing in kinetoplastida. Biochim Biophys Acta 1307(1):39 54 Bañuls AL, Hide M, Prugnolle F (2007) Leishmania and the leishmaniases: a parasite genetic update and advances in taxonomy, epidemiology and pathogenicity in humans. Adv Parasitol 64:1 109 Benne R (1994) RNA editing in trypanosomes. Eur J Biochem 221 (1):9 23 Benne P, Van den Burg J, Brakenhoff JPJ, Sloof P, Van Boom JH, Tromp MC (1986) Major transcript of the frameshifted coxii gene from trypanosome mitochondria contains four nucleotides that are not encoded in the DNA. Cell 46: Decker CJ, Sollner-Webb B (1990) RNA editing involves indiscriminate U changes throughout precisely defined editing domains. Cell 61: Donelson JE, Gardner MJ, El-Sayed NM (1999) More surprises from kinetoplastida. Proc Natl Acad Sci USA 96(6): Estevez AM, Simpson L (1999) Uridine insertion/deletion RNA editing in trypanosome mitochondria a review. Gene 240(2): Feagin JE, Abraham JM, Stuart K (1988) Extensive editing of the cytochrome c oxidase III transcript in Trypanosoma brucei. Cell 53: Folgueira C, Requena JM (2007) Pitfalls of the CAT reporter gene for analyzing translational regulation in Leishmania. Parasitol Res 101(5): Gao G, Kapushoc ST, Simpson AM, Thiemann OH, Simpson L (2001) Guide RNAs of the recently isolated LEM125 strain of Leishmania tarentolae: an unexpected complexity. RNA 7 (9): Hall TA (1999) Bioedit: a user-friendly biological sequence alignment editor and analysis program for windows 95/98/nt. Nucl Acids Symp Ser 41:95 98 Ibrahim ME, Mahdi MA, Bereir RE, Giha RS, Wasunna C (2008) Evolutionary conservation of RNA editing in the genus Leishmania. Infect Genet Evol 8(3): Koslowsky DJ, Bhat GJ, Perrollaz AL, Feagin JE, Stuart K (1990) The MURF3 gene of T. brucei contains multiple domains of

124 Parasitol Res extensive editing and is homologous to a subunit of NADH dehydrogenase. Cell 62(5): Koslowsky DJ, Bhat GJ, Read LK, Stuart K (1991) Cycles of progressive realignment of grna with mrna in RNA editing. Cell 67(3): Laurentino EC, Ruiz JC, Fazelinia G, Myler PJ, Degrave W, Alves- Ferreira M, Ribeiro JMC, Cruz AK (2004) A survey of Leishmania braziliensis genome by shotgun sequencing. Mol Biochem Parasitol 137(1):81 86 Li Q, Zhao Y, Ni B, Yao C, Zhou Y, Xu W, Wang Z, Qiao Z (2008) Comparison of the expression profiles of promastigotes and axenic amastigotes in Leishmania donovani using serial analysis of gene expression. Parasitol Res 103(4): Lukes J, Hashimi H, Zikova A (2005) Unexplained complexity of the mitochondrial genome and transcriptome in kinetoplastid flagellates. Curr Genet 48(5): Martinez LP, Rebollo JA, Luna AL, Cochero S, Bejarano EE (2010) Molecular identification of the parasites causing cutaneous leishmaniasis on the caribbean coast of Colombia. Parasitol Res 106(3): Maslov DA (2010) Complete set of mitochondrial pan-edited mrnas in Leishmania mexicana amazonensis LV78. Mol Biochem Parasitol 173(2): Moreira D, Lopez-Garcia P, Vickerman K (2004) An updated view of kinetoplastid phylogeny using environmental sequences and a closer outgroup: proposal for a new classification of the class Kinetoplastea. Int J Syst Evol Microbiol 54(Pt 5): Nebohacova M, Kim CE, Simpson L, Maslov DA (2009) RNA editing and mitochondrial activity in promastigotes and amastigotes of Leishmania donovani. Int J Parasitol 39(6): Ouakad M, Chenik M, Ben Achour-Chenik Y, Louzir H, Dellagi K (2007) Gene expression analysis of wild Leishmania major isolates: identification of genes preferentially expressed in amastigotes. Parasitol Res 100(2): Peacock CS, Seeger K, Harris D, Murphy L, Ruiz JC, Quail MA, Peters N, Adlem E, Tivey A, Aslett M, Kerhornou A, Ivens A, Fraser A, Rajandream MA, Carver T, Norbertczak H, Chillingworth T, Hance Z, Jagels K, Moule S, Ormond D, Rutter S, Squares R, Whitehead S, Rabbinowitsch E, Arrowsmith C, White B, Thurston S, Bringaud F, Baldauf SL, Faulconbridge A, Jeffares D, Depledge DP, Oyola SO, Hilley JD, Brito LO, Tosi LRO, Barrell B, Cruz AK, Mottram JC, Smith DF, Berriman M (2007) Comparative genomic analysis of three Leishmania species that cause diverse human disease. Nat Genet 39(7): Schneider A (2001) Unique aspects of mitochondrial biogenesis in trypanosomatids. Int J Parasitol 31(13): Seiwert SD (1995) The ins and outs of editing RNA in kinetoplastids. Parasitol Today 11: Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: Simpson L, Thiemann OH, Savill NJ, Alfonzo JD, Maslov DA (2000) Evolution of RNA editing in trypanosome mitochondria. Proc Natl Acad Sci USA 97(13): Souza AE, Myler PJ, Stuart K (1992) Maxicircle CR1 transcripts of Trypanosoma brucei are edited and developmentally regulated and encode a putative iron-sulfur protein homologous to an nadh dehydrogenase subunit. Mol Cell Biol 12(5): Stuart K (1991) RNA editing in mitochondrial mrna of trypanosomatids. Trends Biochem Sci 16:68 72 Stuart K, Allen TE, Heidmann S, Seiwert SD (1997) RNA editing in kinetoplastid protozoa. Microbiol Mol Biol Rev 61(1): Sturm NR, Simpson L (1990) Partially edited mrnas for cytochrome b and subunit III of cytochrome oxidase from Leishmania tarentolae mitochondria: RNA editing intermediates. Cell 61: Sturm NR, Maslov DA, Blum B, Simpson L (1992) Generation of unexpected editing patterns in Leishmania tarentolae mitochondrial mrnas: misediting produced by misguiding. Cell 70(3): Thiemann OH, Maslov DA, Simpson L (1994) Disruption of RNA editing in Leishmania tarentolae by the loss of minicircleencoded guide RNA genes. EMBO J 13(23): Van der Spek H, Speijer D, Arts G-J, Van den Burg J, Van Steeg H, Sloof P, Benne R (1990) RNA editing in transcripts of the mitochondrial genes of the insect trypanosome Crithidia fasciculata. EMBOJ9: Yatawara L, Le TH, Wickramasinghe S, Agatsuma T (2008) Maxicircle (mitochondrial) genome sequence (partial) of Leishmania major: gene content, arrangement and composition compared with Leishmania tarentolae. Gene424(1 2):80 86

125 MATERIALES, MÉTODOS Y RESULTADOS 7.5 Artículo No. 5 Identification of HSP70-RNA messenger interacting proteins in Leishmania braziliensis Mensaje original De: Journal of Proteomics <jprot@elsevier.com> Fecha: A: cpuerta@javeriana.edu.co,conchita_puerta@hotmail.com CC: hirano@yokohama-cu.ac.jp Asunto: Your Submission Ms. Ref. No.: JPROT-D Title: Identification of HSP70-RNA messenger interacting proteins in Leishmania braziliensis Journal of Proteomics Dear Dr. Puerta, Thank you very much for submitting your manuscript to J. Proteomics. It has been carefully evaluated by independent, expert reviewers.they have pointed out interest in your work, but also indicated that Major Revision is required before it may eventually become acceptable for publication in J Proteomics. Thus, if you feel that you can suitably address the reviewers' comments (included below), I invite you to revise and resubmit your manuscript by Jun 24, If you require additional time, please let us know. Please carefully address the issues raised in the comments. I look forward to receiving your revised manuscript. Yours sincerely, Juan J. Calvete, Ph.D. Editor-in-Chief Journal of Proteomics 125

126 Cover Letter Bogotá, July Prof. Juan J. Calvete Editor Journal of Proteomics Dear Prof. Calvete, Thank you very much for your and comments regarding the paper entitled, Identification of HSP70-RNA messenger interacting proteins in Leishmania braziliensis which was submitted for publication in your prestigious journal. The authors appreciate the reviewers comments. In the following paragraphs, you can find a point-by-point response to the questions raised by the reviewers. In the revised manuscript, we have highlighted in green the places in which major changes were made. Also, we have revised the manuscript in order to ensure that it conforms to the journal style. We are very grateful for giving us an extra time in order to present the MS data in the MIAPE standard format, as requested by the Reviewer-1. Thus, for the preparation of the MS data according to "MIAPE guidelines", it was required the contribution of Dolores Gutiérrez-Blázquez (Unidad de proteómica, UCM). Given that this has been a laborious task that only can be made by an expertise; we have seen fit to include her among the authors. We hope you find the revised version of the manuscript suitable for publication in your prestigious journal. Yours sincerely, Dr. Concepción Puerta, PhD cpuerta@javeriana.edu.co Cra. 7 # Of Ed. 52, Bogotá, Colombia Tel.: +57 (1) ; Fax: +57 (1)

127 *Significance For the first time, a riboproteomic analysis of the proteins interacting with the untranslated regions of the heat shock protein 70 (HSP70) mrna from Leishmania braziliensis was carried out. This work provides new insights related to protein factors putatively involved in the regulation of HSP70 gene expression in L. braziliensis, and thereby, contributes to a better understanding of the parasite biology, and ultimately to the development of novel therapeutic interventions for controlling the important diseases caused by this parasite.

128 *Graphical Abstract (for review)

129 *Highlights (for review) Highlights A pull-down/proteomic strategy was used to identify Leishmania HSP70 UTR interacting proteins 34% of the 52 identified proteins were related to RNA translation and structure modification 5 out of the 9 previously uncharacterized hypothetical proteins bear RNA binding motifs 88.5 % of the 52 proteins have not been previously reported in a proteomic map of L. braziliensis A set of proteins, apparently unrelated to mrna expression processes, were also identified

130 *Manuscript Click here to download Manuscript: Ramirez-JP-Manuscript-July08-3.docx Click here to view linked References Identification of proteins interacting with HSP70 mrnas in Leishmania braziliensis C. A. Ramírez a,b, M. A. Dea-Ayuela c,d, M.D. Gutiérrez-Blázquez e, F. Bolas- Fernández d, J.M. Requena b, C. J. Puerta a,* a Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Carrera 7 No , Edificio 52, Oficina 608, Bogotá, Colombia b Centro de Biología Molecular "Severo Ochoa" (CSIC-UAM), Universidad Autónoma de Madrid, Madrid, Spain c Departamento de Farmacia, Facultad de Ciencias de la Salud, Universidad CEU-Cardenal Herrera, Avd Seminario s/n, Moncada, Valencia, Spain d Departamento de Parasitología, Facultad de Farmacia, Universidad Complutense, Plaza de Ramón y Cajal s/n, Ciudad Universitaria, Madrid, Spain e Unidad de Proteómica, Universidad Complutense de Madrid- Fundación Parque Científico de Madrid (UCM-PCM), Plaza de Ramón y Cajal s/n, Ciudad Universitaria, Madrid, Spain * Corresponding author 1

131 Tel: (57-1) Ext 4024; Fax: (57-1) Ext address: CAR MADE 32 FBF 33 JMR CJP 2

132 ABSTRACT HSP70 protein is involved in Leishmania differentiation, apoptosis, antimonyresistance and host-immune response. Therefore, this protein and the regulatory mechanisms of HSP70 gene expression are promising targets for therapeutic intervention against leishmaniasis. The regulation of mrna expression in trypanosomatids operates mostly through the interaction of transacting proteins, and elements located in the untranslated regions of mrnas. The aim of this work was to identify protein factors interacting specifically with the Leishmania braziliensis HSP70 mrnas. Thus, the 5 UTR and the two types of 3 UTRs (UTR-I and UTR-II) from L. braziliensis HSP70 genes were used as baits in pull down assays using total protein extracts from parasites cultured at 26 or 35 C. The captured proteins were resolved by two-dimensional gel electrophoresis (2-D) and identified by mass spectrometry (MS) analysis. As a result, 52 different proteins were identified based on their binding to the L. braziliensis HSP70-mRNAs. As expected, several of the identified proteins were related to RNA metabolism (27%) and translation process (7%). In addition, five hypothetical conserved proteins having motifs related with RNA interaction were also identified (9.6%). Nevertheless, unexpected proteins, apparently unrelated to the mrna expression, were also identified. The biological significance of these and others L. braziliensis detected proteins, including the HSP70 itself, are discussed Key words: Leishmania braziliensis, HSP70 protein, HSP70 UTRs, mrna expression regulation, mass spectrometry, pull-down 3

133 Introduction Parasites of the genus Leishmania are the etiological agent of leishmaniasis, a spectrum of clinical manifestations ranging from self-healing cutaneous lesions (CL), mucosal lesions (MCL) to fatal visceral infections (VL) [1]. Endemic leishmaniasis transmissions have been reported in 98 countries on 5 continents, more than 350 million people are considered at risk of contracting leishmaniasis, and some 2 million new cases occur yearly [2]. In Latin America, CL and MCL are neglected public health problems endemic in 22 countries. Many species of the subgenus Viannia cause the majority of CL cases, whereas MCL is principally caused by Leishmania (Viannia) braziliensis [3]. During its digenetic life cycle, the Leishmania parasite must face a heat shock when transmission from the environmental temperature found in the insect vector to the mammalian-host temperatures. As a result, the heat shock response is induced, and the heat shock proteins (HSPs) play important roles in the adaptation process, influencing the developmental change from promastigotes in sandflies to amastigotes in mammalian hosts [4-9]. HSP70 has been described as one of the pivotal protein responsible for this response, acting as chaperone preventing the formation of non-specific protein aggregates and assisting proteins in the acquisition of their native structures. Indeed, it has been suggested that rather than the heat by itself, HSP levels are responsible for the induction of the differentiation process [11]. Recent studies have also demonstrated that the knockdown by antisense oligonucleotides of the L. donovani HSP70 induces programmed cell death and causes cell-cycle defects [12]. Moreover, disruption of the HSP70-II gene from L. infantum causes a 4

134 deleterious effect on the growth, morphology, and virulence of parasite promastigotes [13]. On the other hand, overexpression of HSP70 protein has been observed in antimony-resistant isolates of several Leishmania species, indicating that this increased expression level confers protection against the metal [14-16]. Also, as HSP70 is abundantly secreted to the extracellular medium and it elicits strong antibody responses and behaves as a potent immunogen, it was dubbed as chaperokine, term coined to denote its role as immunomodulator for the immune system [10, 11]. Overall, these data highlight the essential role played by HSP70 protein in Leishmania virulence, pointing to this gene or the factors regulating its expression as promising targets for therapeutic interventions. Two classes of HSP70 genes, HSP70-I and HSP70-II, sharing the 5 untranslated region (UTR) and the coding region but differing in their 3 UTR, have been described in several Leishmania species [17-19]. In general, these genes are arranged in a single genomic cluster that contains several HSP70-I copies, followed by one HSP70-II copy. In L. infantum, it has been demonstrated that whereas HSP70-I mrnas accumulate in response to heat shock treatment, and are translated at both 26 and 37 C, HSP70-II mrnas do not show a temperature-dependent accumulation, but show preferential translation at heat shock temperatures [17]. In trypanosomatids, most gene transcription is polycistronic and gene expression is controlled by post-transcriptional mechanisms relying on the modulation of mrna processing, mrna stabilization/destabilization, mrna half-life, translation efficiency or post-translational modifications [19-21]. In this 5

135 regards, the study of the cis-regulatory sequences and the trans-acting factors involved in these mechanisms are of the utmost importance. As a variety of regulatory sequences have been located in both the 5 and 3 mrna untranslated regions (UTRs) [22-27], we prompted this study with the aim of identifying protein factors interacting specifically with the Leishmania braziliensis HSP70 mrnas. Thus, the 5 UTR and the two types of 3 UTRs (UTR-I and UTR-II) from L. braziliensis HSP70 genes were used as baits for pull down assays using total protein extracts from parasites cultured at 26 or 35 C. The captured proteins were resolved by two-dimensional gel electrophoresis (2-D) and identified by mass spectrometry (MS) analysis

136 Materials and methods 2.1. Parasite cultures Promastigotes of L. braziliensis (MHOM/BR/75/M2904) were cultured in vitro at 26 C in Schneider s insect medium (Sigma Aldrich, Inc., St. Louis, USA) supplemented with 20% heat-inactivated fetal calf serum (FCS) (Eurobio, Inc., Les Ulis, France), and 0.1 µg/ml of 6-Biopterin (Sigma Aldrich, Inc., St. Louis, USA). For heat shock treatments, 10 ml-aliquots of L. braziliensis promastigote cultures at logarithmic phase (5 9 x 10 6 promastigotes ml -1 ) were transferred into 50 ml flasks, and incubated four hours at 35 C PCR amplification of HSP70 and - tubulin UTR templates for in vitro transcription For amplification of the untranslated regions (UTRs) of L. braziliensis HSP70 gene, the following clones were used: plbhsp70-5b containing the 5 UTR, ptlb3hsp70-d for the 3 UTR-I and plb3h70-11b for the 3 UTR-II [19]. The UTRs of L. braziliensis -tubulin mrna were used as control; they were derived from clone plb5 Tub-D, containing the 5 UTR, and clone plb3 Tub-C6, with the 3 UTR [28]. The aforementioned clones were used as templates in PCR reactions. In order to include the T7 promoter sequence in the 5 end of each amplification product, a set of specific oligonucleotides were designed. Thus, the T7SL primer (5 TAATACGACTCACTATAGGGCGCTATATAAGTATCAGTTTC 3 ) together with either the LH70-CATrw primer (5 GCGCCCTCGAACGTCAT 3 ) or the LaT- CATrw primer (5 TGCAGATAGCCTCACGCAT 3 ) were used for HSP70 and 7

137 tubulin 5 UTR amplification, respectively. For the 3 UTR amplification, the Oligo dt 25 primer (IDT, Inc., San Jose, CA, USA) together with the T7HSP70 primer (5 TAATACGACTCACTATAGGGTCGAGGAGGTCGACTA 3 ) or the T7aTUB 5 (TAATACGACTCACTATAGGGACGTCGAGGAGTACTA 3 ) were used to amplify the 3 UTRs of HSP70 genes or the -tubulin 3 UTR, respectively. The T7 transcription initiation site is underlined in each oligonucleotide sequence. The following PCR reaction mixture was used for all amplifications in a final volume of 50 µl: 1 reaction buffer (10 mm Tris-HCl ph 9.0, 50 mm KCl, 0.1% Triton X-100), 1.5 mm MgCl 2, 0.4 mm of dntp mix, 0.5 µm of each primer (except for Oligo dt 25 primer which was used at 0.8 µm), 1 M betaine, 0.06 units per µl of expand high fidelity enzyme (Roche, Inc., Mannheim, Germany) and 0.25 ng/ l of each plasmid DNA. For amplification of the 3 UTR-I region, it was necessary to add 2 mm MgCl 2 and 1.5 M betaine in the reaction mix. An MJ Research PTC-100 DNA thermocycler was used for the PCR reactions with the following amplification profile: 95 C/5 min (initial denaturation), 5 cycles of 92 o C/0.5 min, annealing at 52ºC /0.5 min and extension for 72 C/1 min, 35 cycles of 92 o C/0.5 min, annealing at 57 o C/0.5 min and extension for 72 C/1 min, with a final incubation at 72 C for 10 min. All the amplified fragments were resolved in agarose gels and visualized under UV exposure after ethidium bromide staining (Supplementary Fig. 1A) In vitro transcription of HSP70 and - tubulin UTRs Each PCR product (Supplementary Fig. 1A), obtained as mentioned above, was purified separately and used as template in an in vitro transcription reaction with 8

138 the MEGAscript T7 kit according to manufacturer's instructions (Ambion, Inc., USA). Afterwards, the transcription products were treated with RNAse free- DNAse and the RNAs purified by the TRIZOL reagent method (Invitrogen, California, USA). Briefly, 20 l of the in vitro transcription reaction were brought to 100 l with DEPC treated water plus 400 l of TRIZOL reagent and 100 l of chloroform. After 2 min of manual agitation by tube inversion, the mixture was centrifuged for 5 min, and the supernatant was precipitated with 500 l of isopropanol. RNA concentration was measured by using a NanoDrop 2000 (Thermo Scientific, Inc., USA) equipment and all RNAs were visualized in 1.5% (w/v) low electroendosmosis agarose/mops/formaldehyde gels (Supplementary Fig. 1B) Preparation of parasite protein extracts L. braziliensis promastigotes were cultured in Schneider's medium as above indicated, and protein extracts for two types of pull-down assays differing in the assay astringency (low and high), were obtained. For the low astringency pulldown assay, protein extracts were prepared as follows: logarithmic phase promastigotes were collected by centrifugation and washed once in cold PBS. The cellular pellet was lysed in 5 ml of a solution containing 10 mm HEPES (ph 7.4), 10 mm KCH 3 CO 2, 1.5 mm Mg(CH 3 CO 2 ) 2, 2.5 mm Dithiothreitol (DTT) and a protease inhibitor cocktail (Sigma Aldrich, Inc., St. Louis, USA); the sample was homogenized by 30 strokes using glass beads. Finally, cellular debris was eliminated by centrifugation at g for 10 min [29]. For the high astringency pull-down assay, parasites were lysed in 0.1 PBS (13.7 mm NaCl, 0.27 mm 9

139 KCl, 1 mm Na 2 HPO 4, 0.2 mm KH 2 PO 4 ) containing a protease inhibitor cocktail (Roche, Inc., Mannheim, Germany). Protein concentration was determined by Bradford assay according to manufacturer's instructions using BSA as standard (Bio-Rad, Inc., Philadelphia, USA). Glycerol (final concentration of 10%) was added to the protein extracts, and they were stored at -80 C until use Pull-down assays Low and high astringency pull-down assays were designed in order to capture the proteins interacting with 5 and 3 UTRs of L. braziliensis HSP70. In parallel, control experiments were performed in which the 3 UTR of L. braziliensis - tubulin gene was used as bait. Taken advantage of the fact that the 5 UTRs have at their 5 end the SL sequence (5 CGCTATATAAGTATCAGTTTC 3 ), 0.1 g/ l RNA corresponding to each 5 UTR were bound to 0.7 mg Streptavidin MagneSphere Paramagnetic Particles (Promega, Inc., Madison, WI, USA) using 0.1 M 3 -biotinilated LbSLrw primer (5 GAAACTGATACTTATATAGCG 3 Biot) in a total volume of 300 l of a 0.5 SSC (75 mm NaCl, 7.5 mm Na 3 C 6 H 5 O 7 ) solution. For 3 UTRs, 0.15 g/ l of the corresponding RNAs were bound to 0.5 mg oligo-dt dynabeads (Dynal Invitrogen, California, USA). After RNA bead binding at room temperature (RT) during 15 min, RNA in excess was washed with 1 binding buffer (10 : 100 mm Tris-HCl ph: 7.5; 1 M KCl; 20 mm MgCl 2 ). For low astringency pull-down assays, protein mixture contained: 0.7x binding buffer, 0.8 g/ l of L. braziliensis soluble protein (3.46 mg of protein for each RNA bait), 1 mm PMSF, 0.1% protease inhibitor cocktail (Sigma Aldrich, Inc., St. Louis, USA), 0.06 U/ l 10

140 241 RNAse inhibitor (Invitrogen, California, USA), and 100 ng/ l yeast trna as RNA 242 competitor. For the high astringency pull-down assay, binding buffer and protein 243 concentration was increased to 1 and 4.6 mg for each RNA bait, also ng/ l yeast trna and 100 ng/ l of Vero cells total RNA were added as RNA competitors; in this assay, the Roche protease inhibitor cocktail was employed. In both pull-down assays, after protein binding to the RNA bait at RT for 20 min, a wash step with 10 mm Tris-HCl (ph= 7.5), 0.1 M KCl and 0.5 mm MgCl 2 was performed, followed by a second wash with 10 mm Tris-HCl (ph 7.5), and 0.5% CHAPS zwitterionic detergent (3-[(3-cholamidopropyl) dimethylammonio]-1- propanesulfonate), and four washes with the 2D protein sample buffer (200 mm urea, 50 mm thiourea, 0.25% CHAPS, 5 mm CO 3 K 2 ). Afterwards, proteins bound to the RNA bait were eluted in a rehydration buffer consisting of 7 M urea, 2 M thiourea, 2% CHAPS, 1% immobilized ph nonlinear gradient (IPG) buffer (ph: 3-11), 0.002% bromophenol blue, and mm DTT. For each pulldown assay, both -tubulin UTR RNAs and beads without RNA bait were used as controls for determining non-specific captured proteins. The obtained proteins were immediately used for Isoelectric focusing (IEF). All the experiments and conditions were performed in triplicate Two dimensional gel electrophoresis The L. braziliensis eluted proteins from pull-down assays were applied to 11 cm immobilized ph nonlinear gradient (IPG) gel strips (Bio-Rad, Inc., Hércules, CA) of 3.0 to 10.0 ph range. After rehydration (16 h at 20ºC), IEF was performed using the Ettan IPGphor 3 system (GE Healthcare) at 20 C using the following 11

141 protocol: 500 V step and hold 1 hour; 1000 V, 1 h; 6000 V, 3 h; 200 V step and hold. After that, the samples on strips were reduced and alkylated by shaking them for 15 min in 5 ml of a solution containing: 75 mm Tris-HCl (ph 8.8), 6 M urea, 30% glycerol, 2% SDS, and mm of DTT. Afterwards, samples were incubated for 20 min in the same buffer solution, excepting for the DTT, which was replaced by mm iodoacetamide. IPG strips were transferred to a Criterion TM XT Bis-Tris precast 4-12% polyacrylamide gel (Bio-Rad, Cat ), run on XT MOPS buffer (Bio-Rad, Cat ) in a Criterion electrophoresis chamber (Bio-Rad, Cat ), by 150 volts (V) for 1.5 h Gel staining and image analysis Each gel was stained with G-250 Coomassie blue (Bio-Rad) as follows: two washes for twenty min each in a solution containing 50% ethanol and 2% phosphoric acid; two washes for twenty min each in a 2% phosphoric acid solution, followed by incubation in the staining solution: 15% (NH4) 2 SO 4, 2.5% phosphoric acid, 20% methanol, and Coomassie G-250 at 0.1% solubilized in methanol. After staining, the gels were faded in 2.5% phosphoric acid solution. Two-dimensional gel images were digitized from gels using a calibrated LabScan 6 scanner (GE Healthcare) with 300 dpi resolution and the generated images were analyzed with the ImageMaster 2-D platinum 6.0 software. The authenticity and outline of each spot was validated by visual inspection and edited where necessary. A virtual gel was created using three replicas of each sample. The differentially expressed spots were identified according to its presence/absence in paired gels of pull-down assays. Firstly, HSP70 and - 12

142 tubulin pulled-down protein gels were compared with the 2-D gel obtained in the pull-down assay without RNA bait (beads without RNA) upon the same conditions of astringency and protein extracts. Common spots were excluded for further analyses. Next, those spots present in gels derived from HSP70 and -tubulin pulled-down assays protein gels were also dismissed. Finally, those spots that appeared in the HSP70-UTR pull-down 2-D gels, but not in the two control assays (beads without RNA or -tubulin RNA bait) were subjected to MALDI-TOF analysis. In the low astringency assay minimal area for spots detection was selected as 0.6 mm 2, and in the high astringency assay minimal area was 1.2 mm Protein digestion, mass spectrometry and database search Protein spot identified in 2-D gels that were present in Leishmania braziliensis HSP70 RNA UTR regions but absent in controls (no relevant RNA or without RNA), were excised for in-gel digestion for further MS analysis at the Genomics and Proteomics Facility of the Universidad Complutense (Madrid, Spain). In-gel digestion of the proteins was performed as described previously [30]. The MS spectra were provided by the AB Sciex 4800 plus MALDI-TOF/TOF mass spectrometer. The combined MS and MS/MS peak lists were searched using the GPS Explorer software version 3.6 (AB Sciex). The MASCOT version 2.2 ( was used as the search engine for protein identification against the NCBI non redundant proteins. Initial search parameters were as follows: Cys as S-carbamidomethyl derivative and Met in 13

143 oxidized form, trypsin digestion with one missed cleavage site was allowed, peptide mass tolerance set at 80 ppm, and MS/MS tolerance of 0.3 Da. As supplementary material, we are providing: representative 2-DE gel images for each experimental condition (Supplementary material 1), MS spectra for each one of the identified protein spots (Supplementary material 2), and the observed masses of the peptides derived from each spot (Supplementary material 3).The MS data are provided according to the Minimum Information about a Proteomics Experiment (MIAPE) reporting guidelines ( produced by the Proteomics Standards. Additional experimental details can be consulted in the link: D=7186&pmRestriccion=1&pmCodigoAcceso=d5ef068f&pmIDUsuario= In silico protein classification The L. braziliensis HSP70-UTR binding proteins captured by pull down/2-d assays and identified by mass spectrometry were subjected to functional pathway analysis using Blast tool from KEGG (Kyoto Encyclopedia of Genes and Genomes) [31] and PANTHER (Protein ANalysis THrough Evolutionary Relationships) software, version 7 [32]. When these tools failed to assign a function for a given protein, the putative biological function was inferred after orthologous identification in the T. brucei database (

144 Results 3.1. Identification of proteins bound to the UTRs of L. braziliensis HSP70 mrna at normal and heat shock temperature In order to identify potential proteins acting as HSP70 regulatory factors, a low and a high astringency RNA/protein pull-down assays with L. braziliensis soluble proteins using either the L. braziliensis HSP70 5 UTR or the two types of HSP70 3 UTRs as baits were carried out. As controls we included the - tubulin UTR regions as baits and beads without RNA bait. Only those spots exclusively found in the pull-down assays with HSP70 UTRs were further analyzed. As shown in Table 1, a total of 71 spots were selected from the low astringency experiment. Of note is that, whereas the majority of spots (90.1%) were identified in protein extracts from parasites cultured at 26 C, only a few of them were obtained when protein extracts derived from parasites submitted to heat shock treatment (Table 1). According to the UTR used as probe, the maximum percentage of spots, 54.9%, was obtained when the 5 UTR was used, followed by the 3 UTR-I, 18.3%, the 3 UTR-II, 12.7%, and 14.1% of spots were common to both types of 3 UTR (Table 1). Examples of identified spots specifically associated with the 5 UTR or the 3 UTRs are shown in Figures 1 and 2. With the aim of narrowing the number of obtained spots, we conducted a second pull-down assay (followed by 2-D and MS identification too) using more astringent conditions during both the process of protein extract preparation and spot selection (see materials and methods for particular details). In this experiment, only 44 spots were selected. However, in contrast to the first 15

145 experiment (low astringency), a larger number of spots could be selected in protein extracts from parasites cultured at 35 C. Again, the maximum percentage of spots, 68.2%, was obtained when the 5 UTR was used (Table 2), followed by the 3 UTR-II (18.2%), and the 3 UTR-I (13.6%) Proteins identified in the pull-down assays Altogether, from both pull-down assays, 115 spots were selected (Tables 1, 2). After MALDI-TOF or MALDI-TOF/TOF analyses, spectra for 78 of them could be obtained. Finally, MASCOT searches allowed the identification of 52 different proteins. The identified proteins were submitted as a query to the KEGG, PANTHER or TriTrypDB databases in order to obtain functional information and protein classification clues (Tables 3-6). As a result, the 52 different proteins (Fig. 3) were classified in the 9 functional groups shown in Figure 4. 34% of these proteins, such as the elongation factor 1 (LbEF-1, LbrM ), the elongation factor 2 (LbEF-2, LbrM ), the initiation factor 4A (LbIF4A, LbrM ), the translation initiation factor 5 (LbIF5, LbrM ), the poly(a)-binding proteins (LbPABP2, LbrM and LbPABP3, LbrM ), and the putative initiation factor 3 subunit K (LbIF3.K, LbrM ), among others, were related to RNA metabolism and translation. This finding was considered as a confirmation that the pull-down assays resulted in a specific enrichment of RNA interacting proteins. Moreover, EF-1, EF-2, the putative ATP-dependent RNA helicase, and the putative mitochondrial RNA binding protein were recovered in both pull-down assay conditions. 16

146 According to the UTR used as bait, five proteins were specifically bound to the 3 UTR-I (LbIF4a, LbrM ; putative protein kinase, LbrM ; pyruvate phosphate dikinase, LbrM ; putative hexokinase, LbrM and LbPABP3, LbrM ), six to the 3 UTR-II (hypothetical protein SCD6.10, LbrM ; putative cystathione gamma lyase, LbrM ; the conserved hypothetical proteins, LbrM and LbrM ; heat shock protein HSP110 putative, LbrM ; glyceraldehyde 3-phosphate dehydrogenase glycosomal, LbrM ) and twenty six to the 5 UTR (Fig. 3, see Supplementary Table 1). Additionally, it is important to mention that some proteins showed interaction with more than one UTR. For instance, the EF-1 showed interaction at 26 C with the 5 UTR and the 3 UTR-I. The EF-2 was captured with the 3 UTR-II at 26 C and with the 5 UTR at 26 C and 35 C. Of note, the putative replication factor 1 (RpaI), the putative ATP-dependent RNA helicase and the putative dihydrolipoamide acetyltransferase precursor protein were found interacting at 26 C with all the HSP70 UTRs. In addition, the RpaI also showed interaction at 35 C with the 5 UTR and the 3 UTR-I. On the other hand, even after increasing the astringency of the pull-down assay in the second experiment, we captured proteins involved in protein, amino acid or nucleotide metabolism, energy metabolism, DNA replication and cell cycle. Apparently, this could be the result of experimental background in the way that the real bound-rna proteins could capture other proteins not necessarily implicated on the regulation of HSP70 expression. However, taking into account that a slightly higher percentage of non-rna related proteins was 17

147 identified in the high astringency pull-down experiment (57.1%, 12 out of 21) than in the low astringency assay (50%, 20 out of 40) and four of these non- RNA related proteins (alpha-tubulin, succinyl-coa 3-ketoacid-coenzyme, putative dihydrolipoamide acetyltransferase precursor and RpaI) were captured in the two pull-down assays, it might be possible that these apparently non- RNA-related proteins may be involved in RNA regulatory processes. Unexpected RNA-binding proteins have also been reported in similar studies, for example in Sacharomyces cerevisiae [33]. On the other hand, it is noteworthy that some proteins like -tubulin, the EF- 1 the putative ATP-dependent RNA helicase, and the putative mitochondrial RNA binding protein were recovered from several spots in the same assay. In addition, 9 out of the 52 identified spots corresponded to proteins previously annotated as hypothetical. Thus, this study, apart from confirming their expression, may be indicating a probable function in RNA metabolism and hopefully in the regulation of HSP70 mrna expression. Finally, 46 out of the 52 identified proteins (88.5%) have not been previously reported in a proteomic analysis of L. braziliensis, confirming here, for the first time, their expression (see Supplementary Table 2) Discussion 18

148 The posttranscriptional regulation of mrna is pivotal for controlling gene expression in trypanosomatids [21, 34]. This control of gene expression at RNA level is ruled by mrna features that contribute to its maturation, stability and translation [21, 35]. Most mapping efforts for identifying RNA cis-elements in Leishmania and trypanosomes have shown that post-transcriptional and translational regulation operates through sequence elements located mostly at the UTRs. Regarding translational regulation, the 3 UTRs have pivotal roles, recruiting the specific transacting factors [21], whereas the 5 UTRs, although also involved, seem to play a secondary role [21, 24, 36]. Posttranscriptional or translational control results from specific RNA/protein interactions [37]. Identification and characterization of RNA binding proteins would be the next step in the process of characterizing the regulatory mechanisms of gene expression in Leishmania; on the other side, these studies might lead to the discovery of new targets for drug design to combat leishmaniasis. With these objectives, we have designed pull-down assays to determine RNA/protein interactions involved in the mrna metabolism of L. braziliensis HSP70, a very relevant protein for this parasite. This is the first riboproteomic analysis of HSP70/UTR interacting proteins reported in L. braziliensis. In this work, 52 different proteins were identified on the basis of their binding to the HSP70 UTR sequences. As expected, many of the 5 UTR-interacting proteins are related to the translation initiation and elongation steps. Thus, the putative eukaryotic translation initiation factor 5 (LbeIF5) and the subunit K of the eukaryotic putative initiation factor 3 (LbIF3.K), both components from the translation initiation complex as well as 19

149 the eukaryotic elongation factors 1 (LbEF-1 ) and 2 (LbEF-2), were found associated to the 5 UTR complexes. On the other hand, those proteins interacting with the 3 UTRs, such as the poly(a)-binding protein 2 and 3 (LbPABP2, LbPABP3), would be involved in mrna stabilization and translational control [21]. Also, as the two L. braziliensis HSP70 3 UTRs are highly divergent in sequence [19], it is not surprising that some of the identified proteins were found interacting exclusively with a particular UTR region. In this regards, it is worthy to note that whereas the LbPABP2 was found associated to both 3 UTRs, the LbPABP3 was only recuperated in pull-down assays in which the 3 UTR-I was used as bait. These findings point to the presence of UTRspecific cis-elements interacting with these proteins, as it has been demonstrated for others trypanosomatid RNA-interacting proteins [22-27]. Also, some proteins were found to be associated to both 5 and 3 UTRs. For example, the LbEF-1 was found attached to the 5 UTR and 3 UTR-I, and the LbEF-2 was selected by its binding to the 5 UTR and 3 UTR-II baits. Proteininteraction with more than one UTR could be explained by the translation closed loop model [38], in which several proteins mediate the physical bridging of 5 and 3 ends of the mrna, thereby, interacting with both the 5 and 3 UTRs. A remarkable observation is that the number of 5 UTR interacting-proteins was greater than those identified based on their specific interaction with the 3 UTR-I and/or 3 UTR-II. This fact is somewhat surprising taking into account that the 3 UTRs are larger than the 5 UTR: the 5 UTR sequence is 198 nucleotides in length, whereas the lengths of the 3 UTR-I and 3 UTR-II are 20

150 and 932 nucleotides, respectively [19]. However, as the HSP70 should be translated efficiently either at normal and heat shock temperatures (during heat shock, most of the mrnas are not translated [17]), it is likely that 5 UTR of L. braziliensis HSP70 mrnas has sequences with high affinity for translation initiation factors and other regulatory proteins. Thus, for example, elements located at the 5 UTR of Drosophila HSP90 mrna were described as essential for preferential heat shock translation [39]. Also, the mrna encoding mammalian HSP70 possesses an internal ribosome entry site (IRES) in its 5 UTR [40]. Additionally, for the Leishmania amazonensis HSP83 mrnas, the 5 UTR was found to be vital for the translation initiation control at normal temperature as well as during heat shock [36]. In summary, it is likely that the Leishmania HSP70 5 UTR is involved in controlling the translation initiation at both, normal and heat shock, temperatures, and that different interacting proteins might be required at each temperature. The fact that more proteins were identified by their binding to HSP70/UTRs in extracts from parasites incubated at 26ºC than in extracts from parasites submitted to heat shock may be a reasonable result. As the RNA-protein interactions were done in vitro, it is likely that as a consequence of the heat shock, most of the HSP70 mrna regulatory proteins are forming complexes with the endogenous HSP70 mrnas, and there are few free proteins able to bind the RNA baits. In this regards, the use of in vivo strategies (by the use of an MS2 tethering approach or similar) have the advantage that it allows the pulldown of premade complexes, in contrast to the in vitro assays in which the 21

151 binding is restricted to the non-assembled, free polypeptides present in the protein extracts. A 34 percentage of the identified proteins were related to RNA metabolism (27%) and translation process (7%). For instance, the EF-1 (LbrM ), which is an abundant protein that besides its role in translation (in charge of delivering all the aminoacyl-trnas to the ribosome), it has also been involved in other cellular processes such as nuclear transport, cellular organization, protein quality control, co-translational degradation and mitochondrial trna import [41, 42]. The EF-2 is known for its function in translocation of the ribosome along the mrna during the translation process [43, 44]. The LbEF2 (LbrM ) has 61.3% and 61.4% identity with that of S. cerevisiae and humans, respectively. A protein belonging to the DEAD-box family, the L. braziliensis homologue to the eif4a (LbrM ), was found attached specifically to the L. braziliensis HSP70 3 UTR-I. This protein, including the homologue in L. major, exhibits RNA-dependent ATPase and bidirectional RNA helicase activities [45, 46]. Additionally, it has been shown that IF4A from L. infantum or L. major interacts with the eukaryotic initiation factor 4G (eif4g) during the translation process [47]. Moreover, L. infantum IF4A has been reported as an inhibitor of the translation machinery in yeast [47]. The putative LbeIF5 (LbrM ), was found specifically attached to the HSP70 5 UTR. The eif5 is an important partner of the eukaryotic initiation factor 2 (eif2), modulating its function in several critical steps during the initiation of the translation process [48]. The LbIF3.K (LbrM ) was found attached to the HSP70 5 UTR. In yeast, the eif3 has been involved in promoting the recruitment of at least some mrnas to 22

152 the translational apparatus, independently of the presence of eif4g [49]. Also it has been proposed that some subunits of eif3 might help to recruit specific subsets of mrnas in stress conditions [49]. Although eif3.k has not been found in yeast [50], the human eif3.k has the potential of RNA binding activity associated with its helix-turn-helix (HTH) motif and it is also suggested that it could act as a structural scaffold for protein-protein and protein-rna interactions [51]. The Leishmania genome encodes three poly(a)-binding proteins (PABP1, PABP2, and PABP3), but only the first two are conserved in Trypanosoma species [52]. Interestingly, attached to both types of HSP70 3 UTRs were found the LbPABP2 (LbrM ) and LbPABP3 (LbrM ) proteins. Functional studies of these proteins in L. major have shown that whereas PABP2 performs essential functions for cellular survival, PABP3 acts redundantly with PABP2 or is required to complement its function [52]. Interestingly, in Crithidia fasciculata, the PABP2 orthologous has been found to be part of a complex that recognizes elements in the UTRs of mrnas whose levels vary periodically during the cell cycle [53]. Conformational changes in complexes that contain RNA play critical role in RNA regulatory processes. DEAD-box RNA helicases drive these changes through ATP-dependent mechanisms that unwind RNA duplexes or disrupt RNA-protein interactions [54]. In this work, one putative RNA helicase (LbrM ), homologous to the Ded1p protein in S. cerevisiae (42.5% identity) [54], was redundantly identified in the pull-down assays with the different UTRs. It has been reported that Ded1p can affect the translation 23

153 initiation process by promoting it or interfering with it [55, 56]. Another putative RNA helicase (LbrM ) was found associated to both the LbHSP70 5 UTR and 3 UTR-II. This helicase has 37.8% of sequence identity with Ded1p in the C-terminal 604-residues, whereas the N-terminal 256 amino acids sequence is divergent. Unexpected, the putative mitochondrial RNA binding protein (LbrM ), located in the parasite mitochondria [57], was captured in both pull-down assays. Since the soluble protein lysates used here could contain organelle proteins and this is a RNA-binding protein, one can postulate that this is an artificial interaction which does not occur in vivo. Also, the putative replication factor 1 (LbRpaI; LbrM ) was identified in pull-down assays with the different UTR baits. This protein has been located in the parasite nucleus [58], and it can be postulated a role for this protein during the nucleo-cytoplasmic transport of the HSP70 RNAs. The -tubulin (LbrM ) and -tubulin (LbrM ), two other proteins that apparently do not have relation with gene expression regulation, were found specifically bound to the HSP70 5 UTR. Interestingly, recent evidences suggest that the cytoskeleton participates in the spatial organization and regulation of translation [59]. The second most abundant group of proteins was related to energy metabolism (21%), followed by protein metabolism (19%). These were unexpected results, since these cytoplasmic proteins do not possess known RNA recognition motifs or RNA binding domains in their structures. However, in S. cerevisiae and other organisms metabolic moonlight enzymes able of binding to RNA sequences have been previously reported [33, 60-62]. Indeed, an 24

154 increasing number of moonlighting enzymes are being describing in parasitic protozoa [63]. Remarkably, another captured protein that recalled our attention was the regulatory subunit of the protein phosphatase 2A (PP2A, LbPR64/A, LbrM ), identified on the basis of its specific binding to the LbHSP70 5 UTR. This protein belongs to a family of serine-threonine phosphatases that play critical roles in cell cycle regulation, cell morphology and development [64]. In human A-431 cells, it has been reported that the activity of PP2A increased when the HSP70 is overexpressed [65]. Significantly, in plants, it has been suggested that PP2A is involved in the adaptive responses elicited to counteract heat stress [66]. Furthermore, in T. cruzi, PP2A has been found to be crucial for the transformation of trypomastigotes into amastigotes [67]. Thus, it may be hypothesized that PP2A, recruited by its affinity with Leishmania HSP70 mrnas, could act dephosphorylating the eif-2, removing in turn the translational block induced by the eif-2 phosphorylation occurring during heat shock. In fact, a translational control through eif-2 phosphorylation has been found to occur during the L. infantum promastigote-to-amastigote differentiation [68]. Finally, as the HSP70 protein (LbrM ) was also found associated to all the UTRs of HSP70 mrnas, it is possible that the HSP70 itself may be responsible of its own expression by an autoregulatory mechanism through the interaction with its coding mrna [69]. In fact, EMSA assays using human HSP70 protein (69.8% identity with L. braziliensis one) has shown that this protein binds directly and specifically to U-rich RNA substrates, like the AU-Rich 25

155 Elements (AREs) [70]. Even more, it has been found that human HSP70 protein also binds and stabilizes endogenous ARE-containing mrnas [71]. Nevertheless, given the chaperone function and sticky nature of HSP70, it cannot be excluded the presence of this protein as an accompanying factor of other RNA-binding proteins. To make the picture more interesting, besides demonstrated for the first time, the physical existence of 46 proteins (which have not been previously reported in any proteomic map of L. braziliensis), we confirmed the expression of 9 hypothetical proteins, 5 of which bear RNA binding motifs. Indeed, the LbrM , LbrM , LbrM , LbrM , and LbrM proteins have structural domains that may be related with regulation of mrna maturation [72], RNA nucleo-cytoplasmic transport [73], stress granules formation [74], enhance of translation [50-51], P-bodies formation [75] and translational silencing [76], respectively (see Supplementary Table 2). Consequently, further investigation addressing the influence of these proteins on L. braziliensis HSP70 gene expression is warranted

156 Conclusions In this work we have shown the usefulness of pull-down coupled to 2-D and mass spectrometry analyses to identify putative RNA binding proteins. In the case of the L. braziliensis HSP70 UTR-interacting proteins, herein an important number of different putative HSP70-UTRs affinity proteins were identified, underlining the complexity of the HSP70 expression regulatory mechanisms. Most of the identified proteins, as expected, were related to RNA metabolism and the translation process, including several hypothetical conserved proteins, whose expression had not been previously demonstrated. Future studies on the roles of these putative HSP70 mrna regulatory proteins in the physiology of Leishmania parasites as well as in their pathogenesis will shed light on the gene expression mechanisms in this parasite; this knowledge, in turn, will help to develop novel therapeutic interventions

157 Acknowledgments CJP s lab was supported by Colciencias (Colombia), Research project No JMR s lab was supported by grants from the Ministerio de Ciencia y Tecnología (BFU ), Comunidad Autónoma de Madrid (S2010/BMD-2361) and the Fondo de Investigaciones Sanitarias (ISCIII-RETIC RD12/0018/0009-FEDER). CAR was supported by Colciencias, Programa Nacional de Doctorados, convocatoria

158 REFERENCES [1] Murray HW, Berman JD, Davies CR, Saravia NG. Advances in leishmaniasis. Lancet. 2005;366: [2] Alvar J, Velez ID, Bern C, Herrero M, Desjeux P, Cano J, et al. Leishmaniasis worldwide and global estimates of its incidence. PLoS One. 2012;7:e [3] Oddone R, Schweynoch C, Schonian G, de Sousa Cdos S, Cupolillo E, Espinosa D, et al. Development of a multilocus microsatellite typing approach for discriminating strains of Leishmania (Viannia) species. J Clin Microbiol. 2009;47: [4] Shapira M, McEwen JG, Jaffe CL. Temperature effects on molecular processes which lead to stage differentiation in Leishmania. EMBO J. 1988;7: [5] Maresca B, Kobayashi GS. Hsp70 in parasites: as an inducible protective protein and as an antigen. Experientia. 1994;50: [6] Quijada L, Soto M, Alonso C, Requena JM. Analysis of post-transcriptional regulation operating on transcription products of the tandemly linked Leishmania infantum hsp70 genes. J Biol Chem. 1997;272: [7] Krobitsch S, Clos J. A novel role for 100 kd heat shock proteins in the parasite Leishmania donovani. Cell Stress Chaperones. 1999;4: [8] Zilka A, Garlapati S, Dahan E, Yaolsky V, Shapira M. Developmental regulation of heat shock protein 83 in Leishmania. 3' processing and mrna stability control transcript abundance, and translation id directed by a determinant in the 3'-untranslated region. J Biol Chem. 2001;276: [9] Bente M, Harder S, Wiesgigl M, Heukeshoven J, Gelhaus C, Krause E, et al. Developmentally induced changes of the proteome in the protozoan parasite Leishmania donovani. Proteomics. 2003;3: [10] Asea A. Initiation of the Immune Response by Extracellular Hsp72: Chaperokine Activity of Hsp72. Curr Immunol Rev. 2006;2: [11] Requena JM. The stressful life of pathogenic Leishmania species. In: Requena JM, editor. Stress Response in Microbiology. Norfolk, UK: Caister Academic Press; p [12] Raina P, Kaur S. Knockdown of LdMC1 and Hsp70 by antisense oligonucleotides causes cell-cycle defects and programmed cell death in Leishmania donovani. Mol Cell Biochem. 2012;359: [13] Folgueira C, Carrion J, Moreno J, Saugar JM, Canavate C, Requena JM. Effects of the disruption of the HSP70-II gene on the growth, morphology, and virulence of Leishmania infantum promastigotes. Int Microbiol. 2008;11:81-9. [14] Biyani N, Singh AK, Mandal S, Chawla B, Madhubala R. Differential expression of proteins in antimony-susceptible and -resistant isolates of Leishmania donovani. Mol Biochem Parasitol. 2011;179:91-9. [15] Brochu C, Haimeur A, Ouellette M. The heat shock protein HSP70 and heat shock cognate protein HSC70 contribute to antimony tolerance in the protozoan parasite Leishmania. Cell Stress Chaperones. 2004;9: [16] Drummelsmith J, Girard I, Trudel N, Ouellette M. Differential protein expression analysis of Leishmania major reveals novel roles for methionine adenosyltransferase and S- adenosylmethionine in methotrexate resistance. J Biol Chem. 2004;279: [17] Folgueira C, Quijada L, Soto M, Abanades DR, Alonso C, Requena JM. The translational efficiencies of the two Leishmania infantum HSP70 mrnas, differing in their 3'-untranslated regions, are affected by shifts in the temperature of growth through different mechanisms. J Biol Chem. 2005;280:

159 [18] Folgueira C, Canavate C, Chicharro C, Requena JM. Genomic organization and expression of the HSP70 locus in New and Old World Leishmania species. Parasitology. 2007;134: [19] Ramirez CA, Requena JM, Puerta CJ. Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization. Parasit Vectors. 2011;4:166. [20] Requena JM. Lights and shadows on gene organization and regulation of gene expression in Leishmania. Front Biosci. 2011;16: [21] Clayton C, Shapira M. Post-transcriptional regulation of gene expression in trypanosomes and leishmanias. Mol Biochem Parasitol. 2007;156: [22] Charest H, Zhang WW, Matlashewski G. The developmental expression of Leishmania donovani A2 amastigote-specific genes is post-transcriptionally mediated and involves elements located in the 3'-untranslated region. J Biol Chem. 1996;271: [23] Mishra KK, Holzer TR, Moore LL, LeBowitz JH. A negative regulatory element controls mrna abundance of the Leishmania mexicana Paraflagellar rod gene PFR2. Eukaryot Cell. 2003;2: [24] Larreta R, Soto M, Quijada L, Folgueira C, Abanades DR, Alonso C, et al. The expression of HSP83 genes in Leishmania infantum is affected by temperature and by stage-differentiation and is regulated at the levels of mrna stability and translation. BMC Mol Biol. 2004;5:3. [25] Purdy JE, Donelson JE, Wilson ME. Leishmania chagasi: the alpha-tubulin intercoding region results in constant levels of mrna abundance despite protein synthesis inhibition and growth state. Exp Parasitol. 2005;110: [26] Zick A, Onn I, Bezalel R, Margalit H, Shlomai J. Assigning functions to genes: identification of S-phase expressed genes in Leishmania major based on post-transcriptional control elements. Nucleic Acids Res. 2005;33: [27] Holzer TR, Mishra KK, LeBowitz JH, Forney JD. Coordinate regulation of a family of promastigote-enriched mrnas by the 3'UTR PRE element in Leishmania mexicana. Mol Biochem Parasitol. 2008;157: [28] Ramírez CA, Requena JM, Puerta CJ. Alpha tubulin genes from Leishmania braziliensis: genomic organization, gene structure and insights on their expression. BMC Genomics 2013; In press. [29] Pacheco A, Reigadas S, Martinez-Salas E. Riboproteomic analysis of polypeptides interacting with the internal ribosome-entry site element of foot-and-mouth disease viral RNA. Proteomics. 2008;8: [30] Dea-Ayuela MA, Ordonez-Gutierrez L, Bolas-Fernandez F. Changes in the proteome and infectivity of Leishmania infantum induced by in vitro exposure to a nitric oxide donor. Int J Med Microbiol. 2009;299: [31] Kanehisa M, Goto S, Hattori M, Aoki-Kinoshita KF, Itoh M, Kawashima S, et al. From genomics to chemical genomics: new developments in KEGG. Nucleic Acids Res. 2006;34:D [32] Mi H, Dong Q, Muruganujan A, Gaudet P, Lewis S, Thomas PD. PANTHER version 7: improved phylogenetic trees, orthologs and collaboration with the Gene Ontology Consortium. Nucleic Acids Res. 2010;38:D [33] Tsvetanova NG, Klass DM, Salzman J, Brown PO. Proteome-wide search reveals unexpected RNA-binding proteins in Saccharomyces cerevisiae. PLoS One. 2010;5. [34] Clayton CE. Life without transcriptional control? From fly to man and back again. EMBO J. 2002;21: [35] Wilkie GS, Dickson KS, Gray NK. Regulation of mrna translation by 5'- and 3'-UTR-binding factors. Trends Biochem Sci. 2003;28:

160 [36] David M, Gabdank I, Ben-David M, Zilka A, Orr I, Barash D, et al. Preferential translation of Hsp83 in Leishmania requires a thermosensitive polypyrimidine-rich element in the 3' UTR and involves scanning of the 5' UTR. RNA. 2010;16: [37] Kramer S, Carrington M. Trans-acting proteins regulating mrna maturation, stability and translation in trypanosomatids. Trends Parasitol. 2011;27: [38] Jackson RJ, Hellen CU, Pestova TV. The mechanism of eukaryotic translation initiation and principles of its regulation. Nat Rev Mol Cell Biol. 2010;11: [39] Ahmed R, Duncan RF. Translational regulation of Hsp90 mrna. AUG-proximal 5'- untranslated region elements essential for preferential heat shock translation. J Biol Chem. 2004;279: [40] Rubtsova MP, Sizova DV, Dmitriev SE, Ivanov DS, Prassolov VS, Shatsky IN. Distinctive properties of the 5'-untranslated region of human hsp70 mrna. J Biol Chem. 2003;278: [41]Mateyak MK, Kinzy TG. eef1a: thinking outside the ribosome. J Biol Chem. 2010;285: [42] Mittal N, Subramanian G, Butikofer P, Madhubala R. Unique posttranslational modifications in eukaryotic translation factors and their roles in protozoan parasite viability and pathogenesis. Mol Biochem Parasitol [43] Justice MC, Hsu MJ, Tse B, Ku T, Balkovec J, Schmatz D, et al. Elongation factor 2 as a novel target for selective inhibition of fungal protein synthesis. J Biol Chem. 1998;273: [44] Noble CG, Song H. Structural studies of elongation and release factors. Cell Mol Life Sci. 2008;65: [45] Gingras AC, Raught B, Sonenberg N. eif4 initiation factors: effectors of mrna recruitment to ribosomes and regulators of translation. Annu Rev Biochem. 1999;68: [46] Dhalia R, Reis CR, Freire ER, Rocha PO, Katz R, Muniz JR, et al. Translation initiation in Leishmania major: characterisation of multiple eif4f subunit homologues. Mol Biochem Parasitol. 2005;140: [47] Barhoumi M, Tanner NK, Banroques J, Linder P, Guizani I. Leishmania infantum LeIF protein is an ATP-dependent RNA helicase and an eif4a-like factor that inhibits translation in yeast. FEBS J. 2006;273: [48] Singh CR, Watanabe R, Zhou D, Jennings MD, Fukao A, Lee B, et al. Mechanisms of translational regulation by a human eif5-mimic protein. Nucleic Acids Res. 2011;39: [49] Hinnebusch AG. eif3: a versatile scaffold for translation initiation complexes. Trends Biochem Sci. 2006;31: [50] Mayeur GL, Fraser CS, Peiretti F, Block KL, Hershey JW. Characterization of eif3k: a newly discovered subunit of mammalian translation initiation factor elf3. Eur J Biochem. 2003;270: [51] Wei Z, Zhang P, Zhou Z, Cheng Z, Wan M, Gong W. Crystal structure of human eif3k, the first structure of eif3 subunits. J Biol Chem. 2004;279: [52] da Costa Lima TD, Moura DM, Reis CR, Vasconcelos JR, Ellis L, Carrington M, et al. Functional characterization of three Leishmania poly(a) binding protein homologues with distinct binding properties to RNA and protein partners. Eukaryot Cell. 2010;9: [53] Mittra B, Ray DS. Presence of a poly(a) binding protein and two proteins with cell cycledependent phosphorylation in Crithidia fasciculata mrna cycling sequence binding protein II. Eukaryot Cell. 2004;3: [54] Yang Q, Jankowsky E. ATP- and ADP-dependent modulation of RNA unwinding and strand annealing activities by the DEAD-box protein DED1. Biochemistry. 2005;44: [55] Beckham C, Hilliker A, Cziko AM, Noueiry A, Ramaswami M, Parker R. The DEAD-box RNA helicase Ded1p affects and accumulates in Saccharomyces cerevisiae P-bodies. Mol Biol Cel. 2008;19:

161 [56] Hilliker A, Gao Z, Jankowsky E, Parker R. The DEAD-box protein Ded1 modulates translation by the formation and resolution of an eif4f-mrna complex. Mol Cell. 2011;43: [57] Sbicego S, Alfonzo JD, Estevez AM, Rubio MA, Kang X, Turck CW, et al. RBP38, a novel RNA-binding protein from trypanosomatid mitochondria, modulates RNA stability. Eukaryot Cell. 2003;2: [58] Neto JL, Lira CB, Giardini MA, Khater L, Perez AM, Peroni LA, et al. Leishmania replication protein A-1 binds in vivo single-stranded telomeric DNA. Biochem Biophys Res Commun. 2007;358: [59] Kim S, Coulombe PA. Emerging role for the cytoskeleton as an organizer and regulator of translation. Nature reviews Mol Cell Biol. 2010;11: [60] Scherrer T, Mittal N, Janga SC, Gerber AP. A screen for RNA-binding proteins in yeast indicates dual functions for many enzymes. PLoS One. 2010;5:e [61] Cieśla J. Metabolic enzymes that bind RNA: yet another level of cellular regulatory network? Acta biochim Pol. 2006;53: [62] Hentze MW, Preiss T. The REM phase of gene regulation. Trends Biochem Sci. 2010;35: [63] Collingridge PW, Brown RW, Ginger ML. Moonlighting enzymes in parasitic protozoa. Parasitology. 2010;137: [64] Janssens V, Goris J. Protein phosphatase 2A: a highly regulated family of serine/threonine phosphatases implicated in cell growth and signalling. Biochem J. 2001;353: [65] Ding XZ, Tsokos GC, Kiang JG. Overexpression of HSP-70 inhibits the phosphorylation of HSF1 by activating protein phosphatase and inhibiting protein kinase C activity. FASEB J. 1998;12: [66] Pais SM, Tellez-Inon MT, Capiati DA. Serine/threonine protein phosphatases type 2A and their roles in stress signaling. Plant Signal Behav. 2009;4: [67] Gonzalez J, Cornejo A, Santos MR, Cordero EM, Gutierrez B, Porcile P, et al. A novel protein phosphatase 2A (PP2A) is involved in the transformation of human protozoan parasite Trypanosoma cruzi. Biochem J. 2003;374: [68] Cloutier S, Laverdière M, Chou MN, Boilard N, Chow C, Papadopoulou B. Translational control through eif2alpha phosphorylation during the Leishmania differentiation process. PLoS One. 2012;7:e [69] da Silva RA, Bartholomeu DC, Teixeira SM. Control mechanisms of tubulin gene expression in Trypanosoma cruzi. International journal for parasitology. 2006;36: [70] Wilson GM, Sutphen K, Bolikal S, Chuang KY, Brewer G. Thermodynamics and kinetics of Hsp70 association with A + U-rich mrna-destabilizing sequences. J Biol Chem. 2001;276: [71] Kishor A, Tandukar B, Ly YV, Toth EA, Suarez Y, Brewer G, et al. Hsp70 is a novel posttranscriptional regulator of gene expression that binds and stabilizes selected mrnas containing AU-rich elements. Mol Cell Biol. 2013;33: [72] Kramer S, Queiroz R, Ellis L, Webb H, Hoheisel JD, Clayton C, et al. Heat shock causes a decrease in polysomes and the appearance of stress granules in trypanosomes independently of eif2(alpha) phosphorylation at Thr169. J Cell Sci. 2008;121: [73] Cushman I, Bowman BR, Sowa ME, Lichtarge O, Quiocho FA, Moore MS. Computational and biochemical identification of a nuclear pore complex binding site on the nuclear transport carrier NTF2. J Mol Biol. 2004;344: [74] Kobe B, Kajava AV. The leucine-rich repeat as a protein recognition motif. Curr Opin struct Biol. 2001;11: [75] Kilchert C, Weidner J, Prescianotto-Baschong C, Spang A. Defects in the secretory pathway and high Ca2+ induce multiple P-bodies. Mol Biol Cell. 2010;21:

162 [76] Wardleworth BN, Russell RJ, Bell SD, Taylor GL, White MF. Structure of Alba: an archaeal chromatin protein modulated by acetylation. EMBO J. 2002;21:

163 Figure legends Fig. 1 - Two-dimensional gel electrophoresis of L. braziliensis protein spots recovered after pull-down with the LbHSP70 5 UTR. Panels A to D correspond to assays using protein extract from parasites cultured at 26 C, whereas panels E to G correspond to assays with protein extracts prepared from parasites incubated at 35 C for 4 hours. Spots analyzed by mass spectrometry are indicated by circles. A) Spot 1275 (red circle), corresponds to the elongation factor EF-1 LbrM ), and spot 1401 (blue circle) to the putative eukaryotic translation initiation factor 5 (LbrM ); B) Spot 1350 (red circle), corresponds to the putative replication factor A (LbrM ); C) Spot 1586 (red circle), corresponds to the conserved hypothetical protein (LbrM ); D) Spot 1130 (red circle), corresponds to the ATP-dependent RNA helicase putative (LbrM ); E) Spot 95 (red circle), corresponds to the elongation factor 2 (LbrM ); F) Spot 191 (red circle), corresponds to the galactokinase-like protein (LbrM ), and spot 206 (blue circle), to the putative UDP-glucose 4'-epimerase (LbrM ); G) Spot 248 (red circle), corresponds to the conserved hypothetical protein LbrM pi and Mw data are indicated on the top and on the left, respectively Fig. 2 - Two dimensional gel electrophoresis of L. braziliensis proteins captured by binding to the two types of LbHSP70 3 UTRs: UTR-I and UTR-II. For the results shown in the figure, protein extracts from parasite cultured at 26 C were used. Spots analyzed by mass spectrometry are indicated by circles. A) Spots 608 of the 3 UTR-I (red circle) and 580 of the 3 UTR-II (red circle) corresponds 34

164 to the putative eukaryotic initiation factor 4 (LbrM ), and spot 414 of the 3 UTR-II (blue circle) corresponds to the hypothetical protein LbrM ; B) Spot 484 of the 3 UTR-II hypothetical protein LbrM and C) Spot 291 of the 3 UTR-II hypothetical protein LbrM pi and Mw data are indicated on the top and on the left, respectively Fig. 3 - Venn diagram of L. braziliensis HSP70 mrna interacting proteins identified in this study. A total of 48 different UTR-interacting proteins were identified: from these, 34 proteins were found to be associated with the 5 UTR, 17 with the 3 UTR-I, and 15 with the 3 UTR-II Fig. 4 - Functional categories of the L. braziliensis HSP70 UTR RNA interacting protein identified by pull down/2-d assays. Pie chart was built with all different proteins. As was aforementioned in methodology, proteins were subjected to functional analysis through BLAST tool from KEGG, PANTHER classification system or by comparison with orthologous in T. brucei database Supplementary Fig. 1 - RNA from UTRs was transcribed in vitro. Plasmids containing each UTR region were used as templates in a PCR reaction in which the forward primer carried at its 5 end the promoter sequence for the T7 RNA polymerase. A) PCR product visualized on agarose gel at 1.5%. These PCR products were purified and used for in vitro transcription. B) In vitro transcribed RNA were visualized on 1.5% (w/v) low electroendosmosis agarose/mops/ formaldehyde gel: 1-5 UTR -tubulin, 2-5 UTR HSP70, 3-3 UTR - 35

165 tubulin, 4-3 UTR-I HSP70, 5-3 UTR-II HSP70. M - Molecular weight (A) 1 kb plus (Invitrogen). (B) RNA Marker G319A (Promega)

166 Table Click here to download Table: Tables 1 and 2 jun 21-3CJPB.docx Table 1 - Number of selected and identified spots according to the UTR used as probe in the low astringency, pull down experiment 26 C 35 C Both temperatures Total Identified Total Identified Total Identified 5 UTR (26) 3 UTR-I (8) 3 UTR-II (6) 3 UTR-I and 3 UTR-II (7) Total (40) The number of spots corresponding to different proteins is indicated in parentheses Table 2 - Number of selected and identified spots according to the UTR used as probe in the high astringency, pull down experiment 26 C 35 C Both temperatures Total Identified Total Identified Total Identified 5 UTR (14) 3 UTR-I (3) 3 UTR-II (4) Total (21) The number of spots corresponding to different proteins is indicated in parentheses

167 Table Click here to download Table: Table3-july 8.docx Table 3 - Protein Identified from soluble extract of parasites associated with LbHSP70 5 UTR PE a Spot GeneDB ID Putative function Mw b PI c Mascot MALDI-TOF Score d SC% e Protein classification LbrM Elongation factor EF RNA transport f LbrM ATP-dependent RNA helicase, putative RNA helicase activity h LbrM Elongation factor Translation g LbrM Putative alanyl-trna synthetase Aminoacyl-tRNA biosynthesis f LbrM Putative dipeptidyl-peptidase 8-like serine peptidase Proteolysis g LbrM Putative ATP-dependent RNA helicase RNA helicase activity h LbrM Elongation factor EF RNA transport f LbrM Conserved hypothetical protein Undetermined LbrM Putative serine/threonine protein phosphatase 2A regulatory subunit lbz03015 mrna surveillance f LbrM Putative T-complex protein 1, theta subunit Protein folding g LbrM Putative vacuolar ATP synthase subunit b Oxidative phosphorylation f LbrM Putative replication factor A DNA replication f LbrM Beta-tubulin Cytoskeleton LbrM Putative mitochondrial processing peptidase alpha subunit Proteolysis g LbrM Putative orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase Pyrimidine metabolism f LbrM Putative eukaryotic translation initiation factor RNA transport f LbrM Putative glycosomal phosphoenolpyruvate carboxykinase Glycolysis / Gluconeogenesis f

168 LbrM Putative phosphoribosylpyrophosphate synthetase Purine metabolism f LbrM Alpha tubulin Cytoskeleton LbrM Alpha tubulin Cytoskeleton LbrM LbrM Putative haloacid dehalogenaselike hydrolase Conserved hypothetical protein (translation initiation factor 3 subunit K) Amino acid biosynthetic process h Translation g LbrM Cytochrome c oxidase subunit V Oxidative phosphorylation i LbrM LbrM Ubiquitin-conjugating enzyme-like protein Putative calpain-like cysteine peptidase 16, Proteolysis g Proteolysis g LbrM Hypothetical protein, conserved LbrM Hypothetical protein, unknown function G2/M transition of mitotic cell cycle i Undetermined LbrM Alpha tubulin Cytoskeleton LbrM Elongation factor EF RNA transport f LbrM Heat-shock protein hsp70, putative Protein folding g LbrM Putative dihydrolipoamide acetyltransferase precursor Glycolysis / Gluconeogenesis f LbrM Succinyl-coA:3-ketoacid-coenzyme A transferase, mitochondrial precursor, putative Valine, leucine and isoleucine degradation f LbrM Putative 2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase Citrate cycle (TCA cycle) f LbrM LbrM Putative mitochondrial RNA binding protein Putative mitochondrial RNA binding protein RNA binding i RNA binding i LbrM Conserved hypothetical protein Nuclear mrna splicing g LbrM Elongation factor Translation g LbrM Galactokinase-like protein Galactose metabolism f

169 LbrM Putative UDP-glucose 4'- epimerase Galactose metabolism f LbrM Conserved hypothetical protein RNA transport f LbrM Chaperonin HSP60, mitochondrial precursor RNA degradation f LbrM Putative replication factor A DNA replication f LbrM LbrM LbrM LbrM LbrM Putative mitochondrial RNA binding protein Putative mitochondrial RNA binding protein Putative mitochondrial RNA binding protein Putative mitochondrial RNA binding protein Putative ribonucleoprotein p18, mitochondrial precursor RNA binding i RNA binding i RNA binding i RNA binding i RNA binding i 1 or 2. Experiment in which the protein was identified: low (1) or high astringency (2). a. (Protein extract). Temperature of culturing L. braziliensis promastigotes before protein extracts (PE) preparation. b. Approximate molecular weight of the identified spot. c. Approximate isoelectric point from identified spots. d. Mascot score. e. Mascot percentage of sequence coverage. f. KEGG Pathway g. Biological process found by Panther h. Molecular function found by Panther i. Inferred function from T. brucei orthologous

170 Table Click here to download Table: Table 4 Jly8.docx Table 4 - Protein Identified from soluble extract of parasites associated with LbHSP70 3 UTR-I PE a Spot GeneDB ID Putative function Mw b PI c Mascot MALDI-TOF Score d SC% e Protein classification LbrM Putative pyruvate phosphate dikinase Pyruvate metabolism f LbrM Putative ATP-dependent RNA helicase RNA helicase activity h LbrM Putative ATP-dependent RNA helicase RNA helicase activity h LbrM Putative ATP-dependent RNA helicase RNA helicase activity h LbrM Putative ATP-dependent RNA helicase RNA helicase activity h LbrM Putative glycosomal phosphoenolpyruvate carboxykinase Glycolysis / Gluconeogenesis f LbrM Succinyl-coA:3-ketoacidcoenzyme A transferase, mitochondrial precursor, putative Valine, leucine and isoleucine degradation f LbrM Putative hexokinase Glycolysis / Gluconeogenesis f LbrM Elongation factor EF RNA transport f LbrM Putative ATP-dependent RNA helicase RNA helicase activity h LbrM Putative poly(a)-binding protein RNA metabolic process g LbrM Putative eukaryotic initiation factor 4A RNA transport f LbrM Putative replication factor A DNA replication f LbrM Protein kinase, putative Protein amino acid phosphorylation g LbrM LbrM See footnotes of Table 3 Heat-shock protein HSP70, putative Putative mitochondrial RNA binding protein Protein folding g RNA binding i

171 Table Click here to download Table: Table5 July 8.docx Table 5 - Protein Identified from soluble extract of parasites associated with LbHSP70 3 UTR-II PE a Spot GeneDB ID Putative function Mw b PI c Mascot MALDI-TOF Score d SC% e Protein classification LbrM Elongation factor Translation g LbrM Hypothetical protein, conserved Undetermined LbrM Hypothetical protein SCD6.10 i RNA catabolic process g LbrM Putative replication factor A DNA replication f LbrM ATP-dependent RNA helicase, putative RNA helicase activity h LbrM Conserved hypothetical protein Cell cycle g LbrM Cystathione gamma lyase, putative Amino acid metabolism g LbrM Heat shock protein HSP110, putative Protein folding g LbrM LbrM See footnotes of Table 3 Glyceraldehyde 3-phosphate dehydrogenase, glycosomal Heat-shock protein HSP70, putative Glycolysis g Protein folding g

172 Table Click here to download Table: Table 6 July 8.docx Table 6 - Protein Identified from soluble extract of parasites associated with LbHSP70 3 UTR-I and 3 UTR-II MALDI-TOF PE a Putative Spot GeneDB ID Mw b PI c Mascot Exp f Protein function classification Score d SC% e LbrM LbrM LbrM LbrM LbrM LbrM Ubiquitin-activating enzyme e1, putative ABC transporter protein, putative Putative ATPdependent RNA helicase Vesicle-fusing ATPase, putative Poly(A)-binding protein 2, putative Putative Dihydrolipoamide acetyltransferase precursor Ubiquitin mediated proteolysis f Translation g RNA helicase activity h Intracellular protein transport g RNA metabolic process g Glycolysis / Gluconeogenesis f LbrM Pyruvate kinase Glycolysis g See footnotes of Table 3

173 Figure Click here to download Figure: Fig 1.docx 66 A B C D LbHSP70 5 UTR RNA a-tubulin 5 UTR RNA E F G LbHSP70 5 UTR RNA a-tubulin 5 UTR RNA Fig. 1 -

174 Figure Click here to download Figure: Fig 2.docx 59 LbHSP70 3 UTR-II RNA A B C LbHSP70 3 UTR-I RNA a-tubulin 3 UTR RNA Fig. 2 -

175 Figure Click here to download Figure: Fig. 3 june 20.docx 3 UTR-I UTR Fig UTR-II

176 Figure Click here to download Figure: Fig. 4 June 20.docx Fig. 4 -

177 Supplementary material Click here to download Supplementary material: Supplementary Material 1.pdf Click here to download Supplementary material: Supplementary material 2.ppt Click here to download Supplementary material: Copia de Supplementary material 3.xls Click here to download Supplementary material: Supplementary fig 1.docx Click here to download Supplementary material: Supplementary Table 1.docx Click here to download Supplementary material: Supplementary Table 2-june 21-3.docx

178 DISCUSIÓN GENERAL 8. DISCUSIÓN GENERAL Con el propósito de generar conocimiento nuevo de importancia para el entendimiento de la biología del parásito L. (V.) braziliensis, en primera instancia, en este trabajo, se estudió la organización y expresión de tres de sus genes, implicados en distintos procesos fisiológicos a lo largo del ciclo de vida del parásito. Así, se estudiaron los genes codificantes para la proteína de choque térmico de 70 kda (HSP70), proteína considerada como un factor de virulencia del parásito (20-22), los codificantes para la -tubulina, proteína implicada en la motilidad y multiplicación del parásito (238) y los codificantes para la subunidad 8 de la enzima nicotinamida adenín dinucleótido deshidrogenasa (ND8), la cual se cree, participa en procesos de óxido-reducción en la mitocondria (271). Organización genómica Genes nucleares Una de las características del genoma de Leishmania es que muchos de sus genes se encuentran repetidos en múltiples copias, las cuales se organizan en agrupaciones o tándem. De modo que, ésta parece ser una estrategia directa del parásito para aumentar de forma coordinada la abundancia de los transcritos de proteínas que requieren ser altamente expresadas, como es el caso de las proteínas de choque térmico y las tubulinas (238, 272). Así, en este trabajo, se estimó la presencia de al menos 7 copias para los genes HSP70 y 8 para los genes -tubulina de L. (V.) braziliensis. De acuerdo con lo anterior, un estudio reciente del transcriptoma de promastigotes de L. (L.) major muestra como los genes codificantes para la HSP70 y la -tubulina se encuentran entre los 50 transcritos más abundantes del parásito (273). 178

179 DISCUSIÓN GENERAL La aparente diferencia en el número de copias entre los resultados aquí expuestos y los publicados en el genoma del parásito ( org/homepage/lbraziliensis), habiendo usado en ambos casos la misma cepa de L. (V.) braziliensis (MHOM/BR/75/M2904), se puede explicar por los siguientes hechos: (i) En el proyecto genoma se reporta la presencia de varios gap o regiones que no pudieron ser secuenciadas en los locus de ambos genes. Para el caso de los genes HSP70, los gap se ubican en la secuencia corriente arriba del gen LbrM ( ) y corriente abajo del gen LbrM ( ). En el locus de la -tubulina, existe un gap entre las posiciones y otro, en la región , corriente abajo de los genes LbrM y LbrM y (ii) Es conocido que el ensamble de secuencias repetidas generadas por la metodología Shotgun suele presentar errores. Así, reportes recientes por Rogers y colaboradores (146) indican, mediante secuenciación masiva, que el genoma de L. (V.) braziliensis contiene 15 copias de los genes -tubulina y 10 de los genes HSP70 (146). La aneuploidía o presentación de copias extra de algunos cromosomas en el genoma, es una característica que a los protozoos les permite adaptarse rápidamente a los cambios de ambiente (5). Distintos estudios han evidenciado la presencia de cromosomas supernumerarios en Leishmania (274, 275), los cuales de hecho varían de una especie a otra y de un clon a otro dentro de una misma especie (5). Así, se considera que para el caso de la cepa MHOM/BR/75/M2904 de L. (V.) braziliensis, la misma usada en este estudio, se ha descrito que la mayoría de los cromosomas son trisómicos, entre ellos los cromosomas 13 y 28 que portan los genes codificantes para las proteínas -tubulina típica y la HSP70, es de anotar que el número de copias de estos genes corresponde al triple del valor determinado, lo cual sin duda es un mecanismo del parasito para manejar la abundancia de estas proteínas. Estudios de Horn (2008) muestran como los genes en multicopia organizados en tándem poseen un uso de codones que favorece su traducción, al 179

180 DISCUSIÓN GENERAL usar ARN de transferencia (ARNt) sobrerrepresentados en la célula. Así, el uso de codones, representado por el denominado codon adaptation index (CAI, por su sigla en inglés), se correlaciona con el nivel de expresión proteica en tripanosomátidos. Adicionalmente, este sesgo en el uso de codones se conserva entre genes sinténicos de los diferentes tripanosomátidos (276). De acuerdo con lo anterior, el CAI ( de los genes HSP70 y -tubulina es de 0,9 y 0,86, respectivamente. Valores de CAI que sugieren un elevado nivel de expresión de ambos genes, teniendo en cuenta que el promedio de CAI para los genes repetidos en tándem en T. cruzi es de 0,63 ± 0,11. Así, el uso de codones es otro de los mecanismos que operan en tripanosomátidos, para favorecer la traducción de los ARNm que codifican para proteínas abundantes en el parásito. Otra de las características del genoma de Leishmania es que algunos de los genes repetidos en tándem comparten regiones 5 transcritas pero no traducidas (5 UTR) y las secuencias codificantes pero difieren en las regiones 3 UTR. Este es el caso de los genes codificantes para las porteínas GP63 (277, 278), - tubulina (279), HSP83 (190, 280) y H2A (281), entre otros. De interés, en los genes HSP70 de especies del género Leishmania como L. (L.) infantum, L. (L.) major, L. tropica, L. (L.) mexicana y L. (L.) amazonensis (14), se ha descrito la particularidad de que solo la última copia del tándem porta la región 3 UTR divergente. L. (V.) braziliensis no es la excepción a esta regla, portando al menos 6 copias de los genes HSP70-I y una copia de los genes HSP70-II, ubicada al final del tándem (figura 5). La estricta conservación de este tipo de arreglo de los genes HSP70 en todas las especies de Leishmania analizadas, sugiere que esta organización particular debe tener un papel funcional importante en el control de la expresión de estos genes (282). 180

181 DISCUSIÓN GENERAL XhoI BamHI BamHI BamHI BamHI BamHI BamHI BamHI XhoI SmaI SmaI SmaI SmaI SmaI SmaI 3 HSP70-II HSP70-I HSP70-I HSP70-I HSP70-I HSP70-I HSP70-I 5 XhoI / BamHI 4.18 kbp XhoI / SmaI 5.14 kbp SmaI / SmaI 3.3 kbp BamHI / BamHI 3.3 kbp SmaI / XhoI 3.8 kbp Figura 5. Representación gráfica de la organización del locus HSP70 en L. (V.) braziliensis. Las cajas rojas representan la 5 UTR, las verdes representan la secuencia codificante, la azul claro la 3 UTR-I y la azul oscuro la 3 UTR-II. Los sitios de restricción y el tamaño de cada fragmento se indican en el esquema. Llamativamente, esta misma organización ocurre en los genes -tubulina de L. (V.) braziliensis, en donde la secuencia corriente abajo del último gen del tándem (LbrM ), tiene una región divergente (figura 6). Esta agrupación peculiar en genes que tienen funciones distintas puede obedecer a una necesidad en particular de proveer al parásito de la suficiente cantidad de proteína en momentos y circunstancias específicas de su ciclo celular. Por ejemplo, de acuerdo con los reportes de Folgueira y colaboradores (2005), mientras que los genes HSP70-I se traducen a mayor velocidad a 26 C que a 37 C, los genes HSP70-II se traducen exclusivamente a 37 C, siendo entonces los genes HSP70-II los responsables de proporcionar la mayoría de la proteína HSP70 bajo condiciones de choque térmico (231). De esta manera, la 3 UTR-II divergente (correspondiente a la última copia del tándem), asegura la expresión de la proteína HSP70 bajo condiciones de choque térmico. Condiciones que pueden extrapolarse al paso de promastigote a amastigote in vivo. 181

182 DISCUSIÓN GENERAL NN ApoI ApoI ApoI Csp451 Csp451 Csp451 Csp kb NN 8.5 kb 3 5 A tub -tub -tub 210 PstI 2 -tub x 3 PstI Csp bp probe 0.68 kb Csp451 B ApoI PstI NN ApoI PstI 3 Csp451 Csp451 Figura 6. Representación gráfica de la organización de los loci -tubulina en el cromosoma 13 (A) y 29 (B) de L. (V.) braziliensis. Las cajas rojas representan la 5 UTR, las verdes representan la secuencia codificante, la azul claro la 3 UTR-I, la azul oscuro la 3 UTR-II y en gris la 3 UTR divergente del gen LbrM Los sitios de restricción y el tamaño de cada fragmento se indican en el esquema. Adicionalmente, ya que los procesos de trans-splicing y poliadenilación están acoplados y la poliadenilación de un ARNm es dependiente de las señales de trans-splicing del gen que se encuentra corriente abajo (166, 283), es posible que los genes que tienen la región 3 UTR divergente estén convenientemente ubicados al final de la agrupación para proveer una velocidad de procesamiento y maduración diferente en relación a los genes internos. De acuerdo con lo anterior, en tripanosomas se ha reportado que ARN dicistronicos se pueden acumular como parte de un mecanismo para controlar la expresión génica, a través del cual los ARN en un estado de latencia traduccional se pueden almacenar para su posterior procesamiento a un ARNm maduro, solo cuando la célula lo requiera (284). De esta forma, los genes HSP70-II pueden originar, en conjunto con la copia HSP70-I corriente arriba, un ARNm dicistrónico que se almacenaría a 26 C hasta su traducción cuando el parásito entre en un hospedero mamífero y se exponga a temperaturas de 37 C. 182

183 DISCUSIÓN GENERAL La variabilidad cariotípica, es otra característica de los tripanosomátidos que evidencia la plasticidad genética de estos organismos. Así, se ha visto que los cromosomas homólogos frecuentemente varían de tamaño (142, 285, 286). De acuerdo con lo anterior, al digerir el ADN genómico de L. (V.) braziliensis con enzimas que flanquean el tándem de los genes -tubulina, se encontró que una de estas enzimas (PstI), genera 3 fragmentos de alto peso molecular de tamaños muy similares, los cuales pueden corresponder a los tándems de genes liberados de cada uno de los cromosomas homólogos (teniendo en cuenta que L. (V.) braziliensis es triploide) (146), los cuales difieren en tamaño debido a un número diferente de copias del gen o a mutaciones en los sitios de restricción de la endonucleasa PstI. Alternativamente, estos resultados pueden deberse a la aneuploidía que presenta este parásito. Llamativamente Rogers y colaboradores postulan que la mayoría de cromosomas en L. (V.) braziliensis son trisómicos (146). Una de las ventajas de disponer de los proyectos genoma de varias especies de Leishmania, es poder hacer estudios de genómica comparativa. Así, al comparar las regiones contiguas a los genes -tubulina entre los genomas de L. (L.) major, L. (L.) infantum y L. (V.) braziliensis se observó que en el genoma de L. (V.) braziliensis se encuentran 2 locus para los genes -tubulina, uno sobre el cromosoma 29 con una copia truncada (LbrM ) y el otro, en el cromosoma 13 con dos copias completas (LbrM y LbrM ) y una secuencia parcial (LbrM ). Al examinar el genoma de L. (L.) infantum, también se observan dos locus para los genes -tubulina, ambos ubicados en el cromosoma 13, uno de ellos con una copia completa (LinJ ) y el otro, con una copia completa (LinJ ) y una truncada (LinJ ). En L. (L.) major, a diferencia de las especies anteriores, solo se observa un locus de los genes - tubulina, ubicado en el cromosoma 13 con 12 copias del gen (137). Al comparar las regiones que flanquean los lóci de los genes -tubulina de las tres especies de Leishmania mencionadas, se observa que esta agrupación ha sufrido 183

184 DISCUSIÓN GENERAL reordenamientos importantes siendo blanco de inserciones y deleciones, que explican la sintenia parcial de estos genes en estas 3 especies del parásito. No obstante lo anterior, dada la presencia de varios gap en la secuencia de los proyectos genomas respectivos, justamente en los loci de los genes -tubulina de L. (V.) braziliensis y en el locus de los genes LinJ y LinJ del cromosoma 13 de L. (L.) infantum, es posible que estos loci adicionales sean producto de un ensamblaje artificial del genoma. Del análisis anterior, suponiendo un ensamble correcto de los datos mostrados en los proyectos genoma de estos parásitos, se originan algunos interrogantes como: 1) Cuál es el propósito de generar un locus adicional de los genes -tubulina en L. (V.) braziliensis y L. (L.) infantum?, 2) cuál es el papel de las variantes de la -tubulina codificadas por los genes LbrM y LbrM ? y más aún, 3) estas variantes pueden ser expresadas por el parásito o se trata de pseudogenes?. Desafortunadamente, los resultados obtenidos por Southern blot no permiten aclarar cuál es el escenario real y se sugieren más estudios para su elucidación Gen mitocondrial En el proceso de clonación de las regiones 3 UTR de los genes HSP70 de L. (V.) braziliensis, uno de los clones aislado, nombrado 600D, presentó homología en sus primeros 155 nucleótidos con una región del maxicírculo de L. (L.) donovani (16). Así, teniendo en cuenta que hasta ese momento no se disponía de la secuencia del maxicírculo de L. (V.) braziliensis y tampoco se conocía la existencia de edición del ARNm en este parásito, se decidió con base en la secuencia del clon 600D, buscar secuencias relacionadas con los maxicírculos en la base de datos de secuencias no ensambladas del genoma de L. (V.) braziliensis ( genedb/lbraziliensis/). La anterior información, en conjunto con ensayos de Southern blot usando como sonda los primeros 155 nt del clon 184

185 DISCUSIÓN GENERAL 600D y análisis bioinformaticos, descritos en el artículo No. 3, permitieron el reporte de la secuencia de dos fragmentos no contiguos de 6535 y 4257 pb del maxicírculo de L. (V.) braziliensis, logrando predecir la ubicación de 13 de los 20 genes codificados por el maxicírculo y de 5 de sus ARN guías (ARNg) (256). En términos generales, los genes detectados guardan sintenia e igual orientación de la transcripción en relación a los genes de los maxicírculos de L. tarentolae, L. (L.) major, L. (L.) donovani y L. (L.) amazonensis (256). En relación al gen ND8, la secuencia pre-editada de L. (V.) braziliensis sugiere la necesidad de un proceso de pan-editing para dar origen al transcrito maduro funcional, incluyendo la generación de los codones de inicio y parada, similar a lo observado en L. tarentolae (287, 288), T. brucei (264), L. (L.) amazonensis (15) y L. (L.) donovani (16). Finalmente, resaltar que la coincidencia de 83,3% en 18 de 24 nt del oligonucleótido directo diseñado para la amplificación de la 3 UTR de los genes HSP70 con la secuencia del maxicírculo, en conjunto con el uso del poli(t) para sintetizar el ADNc de L. (V.) braziliensis, explican la obtención del clon 600D. 8.2 Estructura y expresión de los ARNm Genes nucleares Dados los mecanismos singulares de expresión génica utilizados por Leishmania, el conocimiento de la estructura de los ARNm cobra especial importancia, máxime cuando en sus regiones no traducidas, específicamente en las 3 UTR, se ubican los elementos que en conjunto con factores proteicos gobiernan la expresión génica en estos parásitos. Si bien en la actualidad se dispone del genoma de varias especies del parásito, la anotación de los genes no incluye información sobre las regiones transcritas pero no traducidas (UTR) de estos. Así, en este trabajo a partir de ADNc de formas promastigotes del parásito se amplificaron y 185

186 DISCUSIÓN GENERAL clonaron las regiones 5 y 3 UTR de los genes HSP70 y -tubulina de L. (V.) braziliensis. Para ello, se diseñaron oligonucleótidos utilizando como regiones blanco para éstos, la secuencia del SL que se empalma en el extremo 5 de los ARNm y una secuencia especifica del gen, corriente abajo del codón de inicio, en el caso de la 5 UTR y, una secuencia corriente arriba del codón de parada del gen, junto a un iniciador poli(t), en el caso de la región 3 UTR (ver figura 7). Figura 7. Representación esquemática de la metodología empleada para amplificar las regiones UTR determinadas en este trabajo. Así, en el caso de los ARNm HSP70 se encontró una única 5 UTR de 198 pb que al ser alineada con las secuencias derivadas del genoma mostró una identidad del 99,5% y 98% con las secuencias reportadas de las entradas LbrM y LbrM , respectivamente. En tanto que para la 3 UTR, se encontraron dos tipos, permitiendo clasificar dos grupos de genes, HSP70-I 186

187 DISCUSIÓN GENERAL (LbrM ) y HSP70-II (LbrM ), de acuerdo con su posición en el tándem (ver figura 8) Figura 8. Ubicación de las regiones UTR determinadas para los genes HSP70 sobre el cromosoma 28 en el genoma publicado de L. (V.) braziliensis. El gen LbrM (2990) es portador de la región 3 UTR-I (pentágono azul claro) mientras que el gen LbrM (2970) tiene la región 3 UTR-II (pentágono azul oscuro). Los genes LbrM y LbrM (2980) comparten la región 5 UTR. Cada estrella simboliza un gap en la secuencia. En cuanto a los genes -tubulina, al hacer la determinación de la región 5 UTR en L. (V.) braziliensis, se encontró que esta es 100% idéntica a la secuencia respectiva del genoma con un tamaño de 69 pb, excluyendo los nt correspondientes al SL (GenBank FJ750454). Inesperadamente, se observó que el marco de lectura abierto de dicho gen inicia corriente abajo del ATG asignado por el proyecto genoma, originando una proteína de 451 aminoácidos (aa) en lugar de la predicción del GeneDB de 485 aa. Anotación que fue incorporada por el GeneDB ( (289). En cuanto a la región 3 UTR de los genes -tubulina, ésta tiene 368 nt y una identidad del 99,5% (GenBank FJ750455) con la secuencia corriente abajo del gen LbrM Aunque solo se aisló un tipo de región 3 UTR de los genes -tubulina de L. (V.) braziliensis, es interesante resaltar que el gen LbrM tiene una secuencia 187

188 DISCUSIÓN GENERAL 3 UTR divergente (ver figura 9) y las posibles implicaciones de este hecho, serán discutidas más adelante. A B 2700 Figura 9. Ubicación de las regiones UTR determinadas para los genes -tubulina sobre el cromosoma 13 (A) y 29 (B) en el genoma publicado de L. (V.) braziliensis. El gen LbrM (0200) es portador de la región 3 UTR-I (pentágono azul claro) mientras que el gen LbrM (0190) tiene una región 3 divergente o 3 UTR-II (pentágono azul oscuro). Los tres genes de la -tubulina del cromosoma 13 (0190, 0200 y 0210) comparten la misma región 5 UTR. El gen LbrM (2700) ubicado en el cromosoma 29 tiene una región 3 UTR similar a la del gen 0200 del cromosoma 13. Cada estrella simboliza un gap en la secuencia. Al comparar las regiones UTR de los genes HSP70 y -tubulina con las secuencias del genoma, se encontraron las señales típicas del trans-splicing (figura 10), así como el sitio de poliadenilación caracterizado por estar precedido de residuos de adenina (165). Hechos que confirman la delimitación de las regiones UTR. No obstante, dada la amplia variabilidad en el uso de sitios de 188

189 DISCUSIÓN GENERAL trans-splicing y poliadenilación revelados en el transcriptoma de L. (L.) major (273), es probable que existan mensajeros con regiones 5 y 3 UTR de diferente longitud (figuras 10 y 11). A CTGAAGACGACCCTTCAAGCGCATCTAAGATTCTCCTCCCAACACGCACTCAGGCACCAGTGTACCCAAATAAGCACGAACAAATCACA AGCTCATCATCAGCTTCACCCGACTCCGCTGCTGCTGCCACGTGGGCGGACACCTGCCATGCGTCTCCTCCTCTCACCGTGCCCTTTTT CTCCTGCCCTCTTCGCGAAAACGAAACATGCGCAACGCACACACGCACCCACACCCGCAGTCCTTCACTCTCGTTCTTCGAACAAACAC CCTAAACCGCCTTCTAACCTCTCTTTCTTTTTCTCCAACCATGCGTGAGGCTATCTGCATTCACATCGGCCAGGCCGGCTGCCAGGTCG GTAACGCGTGCTGGGAGCTCTTCTGCCTTGAGCACGGCATCCAGCCCGACGGCTCCATGCCCTCTGACAAGTGCATTGGTGT B GATTCGAGCACGTGGGCACGCTCCGTTGGATGTGTCGTGCGGCTTGGGGGAATGTAGCGACGCGCTTCTCGCACTGAGACACCACCACT GTCTCCCGGTGTTGCTGCACTGCTGCTGCTGCCGCTGCCACGTGGGCGGACACCTGCCATGCGTCTCCTCCTCTCACCGTGCCCTTTTT CTCCTGCCCTCTTCGCGAAAACGAAACATGCGCAACGCACACACGCACCCACACCCGCAGTCCTTCACTCTCGTTCTTCGAACAAACAC CCTAAACCGCCTTCTAACCTCTCTTTCTTTTTCTCCAACCATGCGTGAGGCTATCTGCATTCACATCGGCCAGGCCGGCTGCCAGGTCG GTAACGCGTGCTGGGAGCTCTTCTGCCTTGAGCACGGCATCCAGCCCGACGGCTCCATGCCCTCTGACAAGTGCATTGGTGT C GGGCCAGCGCCGTGGTGGCGCGACAAAGCTGATCGGTGCGCTCTCCCCCCCCCCCTTCCCATCCATCAACGGACGGAGGAGAGGTGCAG CTGGTGCGGCCTTGCGTATCAACTCCCCTTTCTCTCTCTGCCCCACGTCCCCCATCCACCACCCCACACGCAGAGGATCCTAAGCACGC AGTCTCGCTCACGCTCTCCTAAGAGAACACATACGCGCACAGCCATACACCTCTCCTGTGCTGCACTCTATTGCGTAACCCTACAAACC CCCTTTCACACCTTCCGGCGCCTATTTCACCGCCCCCCCCCCCACATACACACACACACACACGTACATACACTACCGCTGCTGCAGGG ATGACGTTCGAGGGCGCCATTGGCATCGACCTGGGCACGACGTACTCGTGCGTGGGCGTGTGGCAGAACGAGCGCGTGGAGA D CCAGCGCCGTGGTGGCGCGACAAAGCTGATCGGTGCGCTCTCCCCCCCCCTTCCCATCCATCAACGGACGGAGGAGAGGTGCAGCTGGT GCGGCCTTGCGTATCAACTCCCCTTTCTCTCTCTGCCCCACGTCCCCCATCCACCACCCCACACGCAGAGGATCCTAAGCACGCAGTCT CGCTCACGCTCTCCTAAGAGAACACATACGCGCACAGCCATACACCTCTCCTGTGCTGCACTCTATTGCGTAACCCTACAAACCCCCTT TCACACCTTCCGGCGCCTATTTCACCGCCCCCCCCCCCCACATACACACACACACACACACACGTACATACACTACCGCTGCTGCAGGG ATGACGTTCGAGGGCGCCATTGGCATCGACCTGGGCACGACGTACTCGTGCGTGGGCGTGTGGCAGAACGAGCGCGTGGAGA Figura 10. Ubicación de las señales de trans-splicing sobre la secuencia del extremo 5 de los genes -tubulina (LbrM y LbrM A; LbrM B) y HSP70 (LbrM C; LbrM D). Las regiones ricas en pirimidinas se resaltan en verde y el dinucleótido AG aceptor se resalta en gris. Para ambos genes las señales usadas en el trans-splicing son las más cercanas al codón de inicio (resaltado en azul claro), sin embargo se indica la presencia de posibles señales alternativas. La secuencia codificante se muestra en letra roja. Por otro lado, la definición de las regiones UTR permite la búsqueda de elementos o motivos que pueden estar implicados en la regulación de la expresión del mensajero respectivo. Así, en este trabajo mediante aproximaciones bioinformáticas y reportes previos en la literatura, se analizaron las secuencias UTR previamente determinadas. Con respecto a los genes HSP70, se identificaron 189

190 DISCUSIÓN GENERAL dos secuencias ricas en pirimidinas (posibles cis-elementos) sobre la 3 UTR-I. Una de estas, ubicada en la posición (5 GCGCTCCCCCTCCT GCCGCCTGTCTTCCTCCCCTT 3 ), contiene tramos de cadena sencilla y comparte 53,8% de identidad con un elemento rico en pirimidinas, encontrado en la región 3 UTR del gen HSP83 de L. (L.) amazonensis, relacionado con traducción preferencial de estos genes en condiciones de choque térmico (196) (ver figura 12 y 13 A). A TGCTGCGCTGGAGAAGGACTACGAGGAGGTTGGCGCCGAGTCCGCCGACGACGCGGGCGAGGAGGACGTCGAGGAGTACTAGGGAGCAG ACTCGTGCCTCGCACTGATGATGTAGATGCACGCGTGCGTGTGGTGCGCGGGACCGCCGCCACGGCGCTTGTGTGCCGGTGTGTGGCGA CCGTCTCGGGGAAGGAGGAGGAGCGCGCGTGCGTGTGCTGCGCCTCCTCTTTTTTCTCCCTCACCGGGTTTTTTTCTGAGGGGACGGGG GGGGGAGGAGGAGGCGCGGATGGCGGAGCGGCCACGCTCTGCCCCTCGCTGCCCTGTGCCTTTTCTCGGCCCCCTCCCCGCCCTCTCCT TCCTCGTGCACGTCTGCCGCGCATGCACACGCGCGCGTTGCCGTAGTGCTGTACCTTCATGGAAAAGGAGAGCCTCGCCTCTCCCTCTC TGTCGCTGATAGACGAATGAGAAAAGGGGGAGAGCAGTGCGCACGCGTGCAGGCGGATTCGAGCACGTGGGCACGCTCCGTTGGATGTG B GAGCGGCATGGGCGGTGGTGCGGGTCCGGCCGCCGGAGCCTCCTCCGGCCCCAAGGTCGAGGAGGTCGACTAGGCTCTGTGTGCACCAG CGGTGCTGTGTTCCGCGCTGATGTGTATGTGCGTGTGGTGGGAGAGGGGCAGATGGTGCGCGCGGCCGTTGTGCCTGCGCCGCGGCTGC GGTGGCACGTGGTACGAGGTTTGTGACACGGACCGTGGCATGAAGACCCGGAAGCGGCCACGCGGCGGCGGTGCGCAAGGGCATGTTGT CTCCCCACTCCCTGGCCCGGGCGGACTGCTGGGGTGCGTGTGATGTGCGGGGCGGGCGAGCATGGCGAGTTCGCTGATGCGGTTGCGTG TTGGTCGGTAATGGTGGAGAGGCGGCCTGCTGGCAGCTCTGTGTGCGTGTCTGTGCGAAGCAGGTGTGCCCGGCACGGTATGCTCGCAC ACACTGGTGCACAAGCACAGCCTCTATCGTTGGTCTCTGTGTTGCGGCTCTCCCTCTACGCTTCAAACGTGTGGCTGATGCAGCGTGTG TGTCCCTCTCGTGTGTGTGTGTGTGTGCGTTGAGCGAGAGCGCATGAGACCGACTCTCTTTCCTCCCCCTACCCGTACTCTGCGCTCCG TGTTCAGTGACACCGGCGAGGGCCGTGCATACGGCCAGCACTCACCCTGAATGCGCGCTGCGTCCCCCTCTCCCTCCCTCAGCTGAGGC CCTATTAACTTTTACCGGCACGCACCGAGAGGGCACACGGCGTCCCCCCCCGCTTGTGTGTGCGTGTGCCCTCTCGGTGCCTCTCTTTT CTTCTTTCCTGTGGCAGCGGATGCGCGGAGCGACTCCTCTACCTCTCGCCATCTTTCGCCCCACGTCCGCGTGCGCGCTCCCCCTCCTG CCGCCTGTCTTCCTCCCCTTCCCTCCTCCTCTGTTCCGTATTTCATTCCGGTGGTACATCGACAAGAAGGACGGCTCCGTGAGTGCCGG CCTGTGCCCCCTTCCCCTTCCTTAATCCCTCCAACCCTACGACTCGCGTACCCACCCCCTACGCGGGGGCTGCCGGCGTGCTCGTCGGT C AAGGTCGAGGAGGTCGACTAGGCTCTGTGTGCACCAGCGGTGCTGTAGTGCTCGCCGGTGAATGCCATATATCCTGCTCACGCCGCTGA TGTATGTCTGGGTGTTGGCGGATGCGGGTTCGCTGATGCCGTGGAGATACTCCTCGAACTGATGGATATGGTGCTACTATGTCCTGTTC AGGTGTTTTTCTGCCTTGCGTTGACGCGCGGGTGTCTTACAGTGGCGCTGCGACGCTCTCTCCTCGCATATGCGGCGTGTCTCTGCGTG TGTGTATGTCTTTTATTTTTTTGTGTGTGTTTTATATTTTTCTCCTTTCGTACTAAGAGCGTTTGCTCACTCCTACCCACCCCACATTA AGCCCCTCCTCCCCTCTCCCCCTCCCGCATTTTGTTTTGTCTTCAAAAATTAGTTCTCTCTTTGTTTCCCGCCCTCTCTCGGTGTCTTG CGCATGAACTCGCAGAGAGTCATCGCACACTCTCCTCTTCCTTAGTCTCTCCCTCTCTCTTTAACGCCCCAACCTGTTGTCGTTCTGTC TTCCACACCCCACTACTGCGGTCACGCTGCATGTGTGTGTGTGTGGGCGCAGTGCCTTCTTGTGTTCTCTCTGTTTTCGCTTTCCCCTT CCACCCGTGGGCAGTAAAGGCGCATAAGCCTGTGCGCTGGTGCGCGAGGGAGGAGAGGACAACGAGCCCGCCTGTCTGCTATAATCGCC GGTGAAGTTGTTCGACACCTTCGCAGGAGAGGAAGTGGATTGATCGCGGCGGTCGGGGCGGAGAGAGGGAGCTGGTGAGAAGGAAAAGA GAGAAAGCATGCAGAGTGAGTGAGCACTCGTTAGGCGGGCTTTGGCAGCGGGAATGCTCACCTGCATGTCTGCAGTGGAGGCTGGCGTT GATTCAGACAAGCCGCCACCGCCATCTGTGCGTTTGTGGACGCGGGAGAATCAAAAAAAAAAAGGAAAAAATCGTAGCAAGCGAAAAAG Figura 11. Ubicación del sitio de poliadenilación del gen -tubulina LbrM (A) y los genes HSP70-I LbrM (B) y HSP70-II LbrM (C). El sitio de poliadenilación determinado experimentalmente (resaltado en gris) es el más próximo al codon terminador (resaltado en azul claro), en rojo parte de la región codificante. El otro cis-elemento putativo (5 ACCGACTCTCTTTCCTCCCCCTACCCGTA 3 ), está en una región altamente conservada entre los nt de la 3 UTR-I (figura 12), posición que concuerda con la localización de una secuencia reguladora identificada en la región 3 UTR de los genes HSP70-I de L. (L.) infantum, asociada con la acumulación de estos mensajeros en respuesta al 190

191 DISCUSIÓN GENERAL choque térmico (175). Al hacer la predicción de la estructura secundaria de estas regiones en L. (V.) braziliensis, se observó que el tramo rico en pirimidinas presentó una identidad del 89,7% con la misma región en L. (L.) infantum y se ubicó en una zona de cadena sencilla (ver figura 13 B). La conformación del ARN en cadena sencilla es una condición importante para que las proteínas de unión a ARN puedan interactuar con el ARN, dado que cuando el ARN adopta una estructura de doble hélice, el surco mayor es demasiado estrecho e impide el establecimiento de puentes de hidrogeno entre las bases nitrogenadas del ARN y los residuos de aa de la proteína implicada (290, 291). En la 3 UTR-II del mensajero de la HSP70 se encontraron 2 motivos, ambos en regiones de cadena sencilla. Uno entre las posiciones (5 ATGTCTTT TATTTTTTTGTGTGTGTTTTATATTTTTCTCCTTTCGTACTAA 3 ), está relacionado con los elementos ARE, (figura 14 y 15 A) elementos conocidos por desestabilizar a los ARNm que los contienen, previamente reportados en tripanosomátidos y en eucariotas superiores (292). El otro motivo, es una región de cadena sencilla rica en citosinas que se ubica en las posiciones (5 CCCCTCCTCCCCTCTCCCCCTCCC 3 ) (figuras 14 y figura 15 B). Según la literatura, las proteínas que se unen a secuencias ricas en citosinas participan en el control post-transcripcional de la expresión génica y tienen un amplio rango de funciones que van desde la estabilización del ARNm y activación de la traducción hasta el silenciamiento traduccional (293). 191

192 DISCUSIÓN GENERAL Li ATCGCCCGAGTGCGCCGGAGGTGCTGCAGAGCGCCTGCTCACCTCGTCCCTGCTGGCTGCTCCAGCCTGCGGGGGTGAGGG------CTC Lmj ATCGCCCGAGTGCGCCGGAGGTGCTGCAGAGCACCTGCTCACCTCGTCCCTGCTGGCTGCTCCAGCCTGCGGGGGTGGGGGCTCTCTCTC Lmx ATCGCCCGAGCGCGCCGGTGGTGCCGCACTGCACTTGCTCACCTCGTCCCTGCTGGCTGCTCTAACCTGCGGGAGCGGGGA Lb --GCTCTGTGTGCACCAGCGGTGCTGTG TTCCGCG---CTGATG Li TCTCTTTCTTGCATCTTCGCTCTCCTGTGCGTGCTGATGTGTACTTGGGCGTGGTGGTGGGTGGTGTGCACCGCCGTTGCGCCG--GCGC Lmj TCTCTCTCTTGCGTCTTCGCTCTCCTTTGCGCGCTGATGTGTGCTTGGGTGTGGTGGTGGGTGGTGTGCACGGCCGTTGCGCCG--GCGC Lmx -CTCTCTCCCGCATCTCCGCTCTCCTTTGCGCGCCGATGTGGGCTCGCGTGTGGTGGTGGGTGGTGTGCACGGCCGCTGTGCCGCAGCGC Lb TGTATGTGCG--TGTGG---TGGGAGAGG-GGCAGATGGTGCGCGCGGCCGTTGTGCCT GCGC Li CGCTGCGGCTGTGGCGCGTGATACGGGGTTTGTGGCATGGACCATGGCATGAAGACCCAGAAGGCGCCACGCGGAGGAGGCGGCAGCCGC Lmj CGCTGCGGCTGTGGCGCGGGGTACGGGGTTTATGGCATGGATCATGGCATGAAGGCCCGGAAGGCGCCACGCGGAGGAGGCGGCGGCGGC Lmx CGCTGCGGCTGTGGCGCGTGGTACGGGGTTTGTGGCATGGATCATGGCATGAAGACCCGGAAGGCGCAACACG------GCGGCGGCGGC Lb CGCGGCTGCGGTGGCACGTGGTACGAGGTTTGTGACACGGACCGTGGCATGAAGACCCGGAAGCGGCCACGCG GCGGC Li AGCGCGCAGGGGCATTGTGCACCTCCCTCCCCCCTTTCACCCCCCGATTCCTAGCAGATGCGAGCTGCCGGAGTGCGTGTGATGCGCGTG Lmj AGCGCGCAGGGACATTGTGCACC-CCCTCCCCCC CCCCAATCCCTAGCAGATGCGAGCTGCCGGAGTGCGTGTGATGCGCGTG Lmx GGCGCGCAGGGGCGTTGTGCACC----TCCCCCC AATCCGTGGCAGATGCGAGCTGCCGGAGTGCGTGTGATGCGTGTG Lb GGTGCGCAAGGGCATGTT GTCTCCCC ACTCCCTGGCCCGGGCGGACTGCTGGGGTGCGTGTGATGTGCGGG Li TGAGCGCATCTGCTCGTTTGCGAGCGAGCATGGCGGGCGTGCGGCAGCGGCGGCGTGTTGGCCGGTAGTGGTGGAGAGGCGGCGTGCTGG Lmj TGAGCGCATCTGCTCGTTTGCGAGCGAACATGGCGGGAGCGCGGCAGCGGTGGCGTGTTGGCCGGTAGTGGTGGAGAGGCGGCGTGCTGG Lmx TGAGCGCATCTGCTCGTTTGCGAGCGAATATGGCGGGCGCGCGGCTGCGGCGGCGTGTTGGCCGGTAGTGGTGGAGAGGCGGCGTGCTGG Lb GCGGGCGAGCATGGCGAGTTCGCTGATGCGGTTGCGTGTTGGTCGGTAATGGTGGAGAGGCGGCCTGCTGG Li CAGCTGTGTGTGTGTGTGT------ATGTGCGTGCGAAGCAGGTGTGCTCGGCGTGGAATGCCCGCACACACACTGCTGCGCAAGCACTG Lmj CAGCTGTGTGTGTGTGTGTGTGTGTATGTGCGTGCGAAGCAGGTGTGCTCGGCGCGGAATGCTCGCGCACACACCGCTGCGCAAGCACTG Lmx CAGCTGTGTGTGCGTGTAT GTGCGCGTGAAGCAGGTGTGCTCGGCGCGGAATGCTCGCACACACACCGCTGCGCAAGCACTG Lb CAGCTCTGTGTGCGTGTCT GTGCGAAGCAAGTGTGCCCGGCACGGTATGCTCG--CACACACTGGTGCACAAGCACAG Li CCTCTATCGTTGGCCTCTGTGCTGCTGCTCTTCCTC----TACACTTCGCATGTGTGACTGGTGCGGTGTGCGTGTCCCTCCCGTGTGTG Lmj CCTCTATTGTCGGTCTCTGTGCTGCTGCTCTCCCTC----TACACTTCGCATGTGTGAATGGTGCGGCGTGCGTGTCCCTCCCGTGTGTG Lmx CCTCTATCGTCGGACTCTGTGCTGCTGCTCTCCCTCCCTGTACGCTTCGTACGTGTGACTGGTGCGGCGTGGGTGTCCCTCCCGCGTGTG Lb CCTCTATCGTTGGTCTCTGTGTTGCGGCTCTCCCTC----TACGCTTCAAACGTGTGGCTGATGCAGCGTGTGTGTCCCTCTCGTGTGTG Li TGTGTGTGTGTGTGTGTATGTGTGTCTGTGCATCTCCTCGAACTGCACCGCCGCGGCTGAGGGCGCACACACGCAGTCCCATGTGCGCGT Lmj TGTGTGTGTG TGCATCTCCTCGAACTGCACCGCCGCGGCTGGGGGCGCACGCACGCTGTCCCGTGTGCGCGT Lmx TGTGTGTGTGTGTG TCTGTGCATCTCCTCGAACTGCACCGCCGCGGCTGAGGGCGCACGCACGCAGTCCCATGTCCGCGT Lb TGTGTGTGTG CGT Li TGAGCGAGAGCGCTTGAGGCCGACCCTCTTTCCTCCCCCTACCCGTGTTCCGCGCTCCGTGTCCTACGACACCGACGAGGACCGCGCACA Lmj TGAGCGAGAGCGCTTGAGACCGACCCTCTTTCCTCCCCCTACCCGTGCTCCGCGCTCCGTGTCTTACGACACGGACCAGGACCGCGCATG Lmx TGAGCGAGAGCGCTTGAGACCGACCCTCTTTCCTCCCCCTACCCGTGTTCCGCCCTCCGTGTCCTGCGGCACGGACGAGGACCGCGCACA Lb TGAGCGAGAGCGCATGAGACCGACTCTCTTTCCTCCCCCTACCCGTACTCTGCGCTCCGTGTTCAGTGACACCGGCGAGGGCCGTGCATA Li CGGCCAGCACTCACCCTGACTGCCCGCCGCG----CCTTTCTCTCCCTTGATGGAGTCCCTGTTAACCTTTACCGTCGCGCACGCACATG Lmj GGGCCAGCGCTCACCCCGACTGCCCGCCGCG----CCTCTCTCTCCCTTGATGGAGCTCCTGTTAACCTTTACCGTCGCGCACACACATG Lmx TGGACAGCACTCACCCTGACTGCCCGCCGCG----CCT--CTCTCCCTTGATGGAGCCCCTGTTAACCTTTGCCGTCGCGCACACGCATG Lb CGGCCAGCACTCACCCTGAATGCGCGCTGCGTCCCCCTCTCCCTCCCTCAGCTGAAGCCCTATTAACTTTTACCGGCACGCAC Li CCGATGCCGCACCATCAGCGTACGGCATCCCCCTTCGCTTTTGTGCGTGCGCGTGTGCGCTTCTCCTT-TGTCTCTTCTCCTCCTTATTT Lmj CCGATGCCGCACCATCAGCGTACGGCATCCCCCTTCGTTTTTGTGTGTGCGCGTGTGTGCTTCTCCTT-TGCCTCTTCACCTCCTTATTT Lmx CCGATGCCGCGCCACCAGCGTACGGCATCCCCCTTCGCTTGTGTGCGTGCGCGTGTGCGCTTCGCCGT-TGTCTCTT---CTTCTTATTT Lb -CGAG--AGGGCACACGGCGTCC--CCCCCCCCCCCGCTT----GCGTGTGCGTGTGC-CCTCTCGGTGCCTCTCTT-TTCTTCTTTCCT Li GCGGCAACTGTGCAGAGCGGGGGAGCGTCGCCGCCGGTGAGTCAGAGGGGAGACGGGG-AGGGAGACAGCGATGGAAGCACG-CCCCTCC Lmj GCGGCAACTCTGCAGAGCGGGGGAGCGCCGCTGCCGGTGACTCAAAGGGGAAACGGGGGAGGGAGACAGCGATGGAAGCACGCCCCCTCC Lmx GCGGCAACTGTGCAGAGCGGGGGAGA CGGTGAG GGGAGGGG CGCG----CCTC Lb GTGGCAGCG--GATGCGCGGAGCGACTCCTCTACCTCTCGCCATCTTTCGCCCCACGTCCGCGTG CGCGCTCCCCCTCC Li CCTCGCTGTCTCCCCCCCCCTATGCCCCCTCTTCGCCTAT-CATTTCAGTCTTGAGTTTCATCGATAAGAAGGCCCGACTCCGCGAGTGC Lmj CCTCGCTGTCTCCTCCCCCCT---CCCCCTCTTCGCCTAT-CATTTCAATCTTGAGTTTCATCGATAAGAAGGCCCGACTCCGCGAGTGC Lmx CATCGCTG--TCCTCCCCCCT--CCCTCCTCTTCGCCTAT-CTTTTCAGTCTTGAGCTTCCTCGATAGGAAGGCCCGACTCCGCGAGTGC Lb TGCCGCCTG-TCTTCCTCCCCTTCCCTCCTCCTCTGTTCCGTATTTCATTCCGGTGGTACATCGACAAGAAGG-ACGGCTCCGTGAGTGC Li CGACCTGTGCCCCCTCCCCCTT-CCTTAA 1172 Lmj CGGCCTGTGCCCCCTCCCCCTTTCCTTAA 1158 Lmx CGGCCTGTGCCCCCTCCCCCCT-CCTCAA 1093 Lb CGGCCTGTGCCCCCTTCCCCTT-CCTTAA 936 Figura 12. Alineamiento múltiple de las regiones 3 UTR-I de los genes HSP70 de L. (L.) infantum (Li), L. (L.) major (Lmj), L. (L.) mexicana (Lmx) y L. (V.) braziliensis (Lb). En gris se destaca una región conservada, en rojo la secuencia de los dos cis-elementos ubicados en regiones de o próximas a cadena sencilla según predicción con RNAfold. 192

193 DISCUSIÓN GENERAL Figura 13. Identificación de cis-elementos sobre la estructura secundaria de la región 3 UTR-I de los genes HSP70 de L. (V.) braziliensis. Se detectó una región relacionada con un elemento rico en pirimidinas, presente en la 3 UTR de los genes HSP83 de L. (L.) amazonensis que está involucrado en traducción preferencial frente al choque térmico (A). El otro elemento está relacionado con la acumulación de los transcritos HSP70-I de L. (L.) infantum en respuesta al choque térmico (B). 193

194 DISCUSIÓN GENERAL Li ATCGCCCGAGTGCGCCGGAGTGCTGTGAAACTTCTGCTCGTGTTCGCGC--CGCTTTTTTTTTGCT-TCGCGAATGCGTGTAGG Lmj ATCGCTCGAGT GCTGTGAAACTTCACCCCACGTTTGCACTGCACTGTATGTTTACTCTTTCTATTGTGCCTAGG Lmx ATCGCCCGAGC GCTGTGAAACAGCCTCCCATGTATGCGCTGCATTTATTTTGTTCG----CCTGTAGGCCAAGG Lb GCTCTGTGTGCACCAGCG GTGCTGTAGTGCT--CGCCGGTGAATGCCATATATCCTGCTCACGCCG-CTGATGTATGTCTGGG Li TGGTTTGTAGG-GCGCCGCTGCTATTCCCCGGGAATGCACACCACCACCTGATAGATTCTGTGTG TGTGCT---C Lmj TGATGTGCGGCTGCGCCTTTGCTGCTCCCCTGTAATGGACACCACCACTTGATAGATTGTGTGTGTCTTTGTGTT-TGCGTGCGCT---C Lmx TGATATGGGAG-GCGCCGTCCTTATTCCCGGGAAACGCACACCACCACTTGATAGATTTTCTCTG TGTGTGTGCT---C Lb TGTTG-GCGGATGCGGGTTCGCTGATGCCGTGGAG-ATACTCCTCGAACTGATGGATATGGTGCTACTATGTCCTGTTCAGGTGTTTTTC Li TCTGTAGCTCTGCTGCGC-----TTTTTCGAGTGC----CGTCGCTC------CGCGTGTCGTTTG-TGTCTAT-----TCTGAATTTGT Lmj TCCGTCGCTCTGCCGCAC-----TGTGTCGAGTGT----CATGAGTG------CGCGTGTTGTTCGGTGTCTAT-----TGTGAATTA-T Lmx TCCGTCCCGCTGCCGCGC-----TCTCTCGACTGC----CGTCGTTC------TGCGTGTCGTGTG-TGTCTCG-----TCTGAAGTATC Lb TGCCTTGCGTTGACGCGCGGGTGTCTTACAGTGGCGCTGCGACGCTCTCTCCTCGCATATGCGGCG-TGTCTCTGCGTGTGTGTATGTCT Li TCTACGTTTTT TTTCCGTTTTATTTCGGAAGACTTCCGCGTGCTAAATCC---CCCCTTTCCCCCGTAACC-CCCCTCCCCC Lmj TCTGCATTTTTGGTT-TGTTTTGAATCTTATTTCGGAAGACTTCCGCGCGCTAAATCCTCCCCCCCCCCCCCCATTCCC-CCCTTCCCCC Lmx TCTGTTTTTTTTCG-----TTTGGG--TTGTTTCAAAAGACCCCCGCGCGTTAATATCCTCCTCCCCCCAACACACACT-CTTCTCCCCC Lb TTTATTTTTTTGTGTGTGTTTTATATTTTTCTCCTTTCGTACTAAGAGCGTTTGCTCACTCCTACCCACCCCACATTAAGCCCCTCCTCC Li TTTTTTTCTCTACG TCTGTTTCGCCTTATTT TATATATATATATAT---ATTATGGTACCGCCACC Lmj CTCCCCGCCCCCCGATAACTCTCCCTTCCCCCTTGTTTGTCTGCGTCCGTTTCGCTATATATATATATATGATATTATGGTATCGCCACG Lmx TTCCCGTAACTCCC---CCTCCCTACTCTTCCTTCTCTGCGTCAGGTTTGCCTCATATATATTTATATTATATTTTATGGTACCGCCACC Lb CCTCTCCCCCTCCCG CATTTTGTTTTGTCT TCAAAAATTAGTTCTCTCTTTGTT-TCCCGCCCTC Li GCTCACGCTCTCGCATTCACA----GAGAGCCGTCCCTATCCACTCTTTCTCCCTCTTGTCCCTCACGCTGTCCATCGTACTAGCCACCC Lmj GCGCATGCTCTCGCATTCACA----GAGAGCCGTCTTTTTCCCCTCTCCCTCCCTCTTGTCCCTCAAGCTGTCCCTCGTACTACCCAGTC Lmx GCTCACCCTCTCGCGCACACACAGAGAGAGCCGTCCTTCTCCCCTCTCCCTCCCTCTTCTCCCTCACGCAGCCCCTCGTACTATTCACCC Lb TCTCGGTGTCTTGCG----CA-----TGAACTCGCAGAGAGTCATCGCACACTCTCCTCTTCCTTAGTCTCTCCCTCTCTCTTTAACGCC Li CCTCCCGC--CCCTACTTTTCCGCTGTCGGTCTTTCTAGTCCACACTCAAATACCACAACCACGGTGCCTGCGGCGCTGTGGGTGTGCGT Lmj CCTCCCGG--CCCCACTTTTCCGCTGTCGGTCTTTCCAGTCCACACCCAACTACCACGGCCACAGTGCGTGCGGCACGTTGTGTGTGCGT Lmx CCCCCCACGTCCCCACTCTTGTGCTGTCGGTCTTTCTCGTCCACACCCAACTACCACAGCTACGGCGCGTGCAGCACTGTG--TCTACGT Lb CCAACCTG TTGTCGTTCTGTCTT--CCACACCCCACTACTGCGGTCACGCTGCATGTG TGTGT Li TGGTGTGCACATGGCGGGCTTGTGGACTCTCTGTTTGTCGATCTCGTTCCCCTTCCACCAGTCG-CAGTTTACGCGCGAAGCCCTGCTGG Lmj TGGTGTGCACATTGCAGGCTTGTAGACTCTCTGTTTGTCGTTCTCGTTCCCCTTCCACCAGTCG-CAGTTGAGGCGCTAAGCCCTGCTGG Lmx TGGTGTGCACATTGCAGGCGTGTTGACTCTCTGTTTGTTATTCTCGTTCCCCTTCCACCAGTCG-CAGGATCCGTGCAACGCTCTGCTGA Lb GTGTGGGCGCAGTGCCTTCTTGTGTTCTCTCTGTTT-----TCGCTTTCCCCTTCCACCCGTGGGCAGTAAAGGCGCATAAGCCTGTGCG Li CTGGTGCGCGAGGGAGGAGAGGCCCACCAGCCAGCGTGTGTGCCACACTCTCTGGCAGGG-TTGCTTGCCGGCTTTGTAGCTGAGGACGT Lmj CTGGTGCGCGAGGGAGGAGAGGCCCACTAGCCTGCGTGTGTGCTACACTCTCTGGTACAG-CTGCTTGCCAGCTGAGTAGCAGAGGACAT Lmx CTGGTGCGCGAGGGAGGAGAGGCCAACGAGCCTGCGTGTGTGCTACACTCTCTGGTAAGGTTTGCCTGCCAGCTTTGTAGCAGAGGACAT Lb CTGGTGCGCGAGGGAGGAGAGGACAACGAGCCCGCCTGTCTGCTATAATCGCCGGTGAAG-TTGTTCGACACCTTCGCAGGAGAGGAAGT Li GGACAGATCACACCGTTGGGGGCGTAGAGAGAGGGAGCGTGCAG--TGGGTGAAAGCTCGGCAGGCGGGCGACGGCAGCGAGGATGCTCA Lmj GAATAGATCGCACCGTGGGAGGGGTAGAGAAAGGAAGTGTGCAGAGTGGGTGAAAGCTCGGCAGGCGGGCGACGGCAGCGAG Lmx GGATAGATCGCAGTGGTGGAGGCGTAGAGAGAGGGAGTGTGCAGTGTAGGTGAAAGCTCGGCAGGCGGGTGACGGCAGCGAGGATGCTCA Lb GGATTGATCGCGGCGGTCGGGGCG--GAGAGAGGGAG CTGGTG--AGAAGGAAAAGAG Li CTGCACGTCTGCATCGAGGTGCGTGTGGATGCACGCAAGCCGCCTCAGCA---ATCTACGCGTCTGTGTGTGTGCGAGAGAGCGAATTAA Lmj GTGCACATGGATGCACGCAAGCTGGCTCAGCA---ATCTACGCGTCTGTGTGTGTGCGAGAGAGCGAATTAA Lmx CTGTAGGTCTGCATCGAGGTGCGTGTGGATGCACGCAAGCCGCCTCAGCAGCAATCTGCGCGTCTCTGTGTGTGCGAAAGGTCGAATCGA Lb AGAAAGCATGCAG AGTGAGTGAGC Li AGAAGAG---AAGAAGAGAGACGACGGAAGTGCGCGCGCAAACCAGGAAAGCCAACCGGCTTCCACACCCACAAACCCCCCG-TCGCTTT Lmj AGAAGAGAACATGAAGAGAGACGACGGAAGTGCGCGAGCAAACCCGGAAGGCCAACGGGCTTCCACACCCGCAAACCCCCG--TCGCGTC Lmx AGAAGAGAATAAGAAGAGAGACGACGGAAGTGCTCGAGCAAGCATG-AAAGCAAACGGGCTTCCACACCCACAAGCCCCCCTGTCGCGTC Lb ACTCGTTAGGCGGGCTTTGGCAG CGGGAATGCTCACCTGCATGTCTGCAG Li TGATTTCTCGTTGTCTGGCACTCACATCAGCTCTCTCCCT--GTCTCTCCTTTATGGAGCATGACGATACGGTAACATGCAGTGCGAGCA Lmj CGATCTCTCGTTTTCTGGCACTTACATGAGCTCTCTCCCTCTGTCTCTCCTTTATGGAGCATGTCGATACAGTAACATGCAGTGCGAGCA Lmx GAATCTCTCGTTGTCTGGCACTTAGGTCGGCTCCCTCCCTCTGTCTCTCCTTTGTGGAGCATGACGATACGGTAACATGCAGTGCAAGCA Lb TGGAGGCTGGCGTTGATTCAGACAAGCCGCCAC-----CGCCATCTGTGCGTTTGTGGACGCGGGAGAAT------CAAAAA Li CTGGAAAA 1071 Lmj CTGGAAAA 1096 Lmx CTGGAAAA 1107 Lb AAAAAA 932 Figura 14. Alineamiento múltiple de las regiones 3 UTR-II de los genes HSP70 de L. (L.) infantum (Li), L. (L.) major (Lmj), L. (L.) mexicana (Lmx) y L. (V.) braziliensis (Lb). En gris se sombrea la secuencia de los dos cis-elementos ubicados en regiones de o próximas a cadena sencilla según predicción con RNAfold. 194

195 DISCUSIÓN GENERAL ARE AAUUUUAAAAUUUAUUUAAUGU-UGUUUUG-AUUUAUUUAUUUU------AA H70-II AUGUCUUUUAUUU-UUUUGUGUGUGUUUUAUAUUUUUCUCCUUUCGUACUAA * * * **** *** *** ****** **** * * *** ** A B CCCCUCCUCCCCUCUCCCCCUCCC Figura 15. Identificación de cis-elementos sobre la estructura secundaria de la región 3 UTR-II de los genes HSP70 de L. (V.) braziliensis. Se detectó una región relacionada con los elementos ARE, la secuencia subrayada es de cadena sencilla (A). El otro elemento es una región rica en citosinas que en su mayor parte es de cadena sencilla (B). Por su parte, análisis de la secuencia de los genes -tubulina de L. (V.) braziliensis, sugieren la presencia del elemento PRE relacionado con transcritos que se expresan abundantemente en promastigotes (171, 176), sobre la región 3 195

196 DISCUSIÓN GENERAL UTR del gen LbrM (Artículo 2), mientras que en la región comprendida entre el codón terminador del gen LbrM y 370 nt corriente abajo de este (3 UTR divergente), se identificó una secuencia relacionada con elementos ARE, como el encontrado en la región 3 UTR-II de los genes HSP70 (292) (Artículo 2). La presencia de dos tipos de 3 UTR (I y II), tanto en los mensajeros de los genes HSP70 como en los de los genes -tubulina, podría contribuir a asegurar la expresión de niveles adecuados de estos genes bajo distintas condiciones fisiológicas, similar a lo reportado para las dos regiones 3 UTR de los genes HSP70 de L. (L.) infantum (231). En donde, la proteína HSP70 derivada de los genes HSP70-I, se expresa principalmente a 26 C, mientras que la derivada de los genes HSP70-II se expresa exclusivamente a 37 C. Adicionalmente, la presencia de potenciales cis-elementos en las regiones 3 UTR-I y II de ambos genes, concuerda con la propuesta anterior. Finalmente, mediante ensayos de Northern blot usando diferentes condiciones de cultivo de promastigotes del parásito, se estudió la expresión de los genes HSP70 y -tubulina de L. (V.) braziliensis. En relación a los genes HSP70 en L. (L.) infantum, se ha demostrado que el ARNm del gen HSP70-I se acumula en respuesta al choque térmico y se traduce tanto a 26 como a 37 C, mientras que el ARNm del gen HSP70-II no muestra una acumulación dependiente de la temperatura, pero se traduce preferencialmente a temperaturas de choque térmico. Este sistema de regulación asegura la disponibilidad de suficiente cantidad de la proteína HSP70 a ambas temperaturas (231). De hecho, la deleción del gen HSP70-II de L. (L.) infantum es perjudicial para el crecimiento, la morfología y la virulencia de promastigotes en ratones (21). Hallazgos que se correlacionan con la falta de progresión en el ciclo celular a partir del paso G 2 /M, cuando el parásito se encuentra en fase estacionaria a 26 C o en estadio amastigote a 37 C (21). Como consecuencia, los promastigotes en fase estacionaria no se transforman en las formas infectivas (promastigotes metaciclicos) y los amastigotes tienen una baja tasa de replicación. 196

197 DISCUSIÓN GENERAL Llamativamente, la expresión episomal de la HSP70 rescata al parásito de estos eventos. De acuerdo con lo anterior, parásitos mutantes carentes del gen HSP70- II, pierden la capacidad de inducir patología (22). Para los genes HSP70 de las demás especies de Leishmania analizadas, se describe un comportamiento similar (14). Sin embargo, para el caso de L. (V.) braziliensis, se encontró que la abundancia de los ARNm de la HSP70-I y II no es afectada por el cambio de temperatura de 26 a 35 C. Teniendo en cuenta que estudios previos muestran que la síntesis de novo de la proteína HSP70 de L. (V.) braziliensis aumenta en condiciones de choque térmico (14), los resultados del Northern blot, indican que los mecanismos de regulación que aseguran una mayor disponibilidad para el parásito de proteína HSP70 a 35 C, ocurren a nivel de la traducción, ya sea aumentando la eficiencia de este proceso o a través de la estabilidad de la proteína o modificaciones post-traduccionales de la misma. De hecho, en algunos casos la misma proteína interviene en su propia regulación (autoregulación), como es el caso de las tubulinas de T. cruzi (249). De forma interesante, se conoce que las modificaciones post-traduccionales relacionadas con control de la expresión, como fosforilación, metilación, acetilación, glicosilación, entre otras, ejercen un efecto directo sobre la estabilidad, recambio, localización subcelular y actividad de las proteínas (20). Por ejemplo, en L. (L.) donovani se observó que la abundancia relativa de las modificaciones post-traduccionales varía entre promastigotes y amastigotes axénicos (294) y, para el caso de proteínas chaperonas como la HSP70, se encontraron fosforiladas con mayor abundancia en amastigotes que en promastigotes (295). También es importante mencionar, que si se supone que los genes HSP70-I y II de L. (V.) braziliensis aportan la gran mayoría de la proteína HSP70 a 26 y 35 C, respectivamente (como sucede en L. (L.) infantum), se sugiere que la presencia de los dos putativos cis-elementos en las regiones 3 UTR-I y II podrían estar mediando la traducción o silenciamiento traduccional de estos transcritos a 26 o 35 C. 197

198 DISCUSIÓN GENERAL En relación a los genes -tubulina de L. (V.) braziliensis, en este trabajo se demostró que la abundancia de los ARNm de estos genes disminuye cuando los parásitos son incubados a la temperatura del hospedero (35 C), observándose de forma simultanea cambios morfológicos similares a los que sufren los parásitos en la transición de promastigote a amastigote. Esta disminución en la abundancia de los ARNm de los genes -tubulina, se relaciona con observaciones previas en las que se demuestra que el estadio amastigote sintetiza menor cantidad de tubulinas (248). También, en este trabajo se demostró que la inestabilidad a 35 C de los ARNm de la -tubulina de L. (V.) braziliensis, es dependiente de la síntesis de proteínas, lo que sugiere la existencia de un factor proteico lábil implicado en la desestabilización de estos transcritos a la temperatura del hospedero. Factor que podría estar interactuando con el elemento PRE, presente en la región 3 UTR-I, desestabilizando estos mensajeros a 35 C, en el estadio amastigote. Por su parte, el elemento ARE de los transcritos con 3 UTR-II, podría favorecer la traducción de estos transcritos a 35 C, pues aunque en menor cantidad, los amastigotes también necesitan la expresión de -tubulina. A este respecto, cabe mencionar que al haber utilizado como sonda la región codificante en los estudios de Northern blot, la diferencia entre los transcritos 3 UTR-I y II no pudo ser observada en nuestras condiciones de estudio Gen mitocondrial El proceso de edición del ARNm ha sido ampliamente estudiado en algunos tripanosomátidos como T. brucei. En este parásito, se conoce que las formas procíclicas obtienen su energía de la fosforilación oxidativa (complejos II y IV) de la prolina presente en el intestino del vector o de la glicolisis de los azúcares presentes en la sangre ingerida por el insecto durante su alimentación (296). Por tanto, las formas procíclicas tienen una mitocondria activa y 12 de sus 17 transcritos sufren edición con el fin de sintetizar algunas de las proteínas 198

199 DISCUSIÓN GENERAL requeridas para la fosforilación oxidativa. En contraste, cuando el parásito se encuentra en la sangre del hospedero mamífero como tripomastigote, este obtiene la energía de la glicolisis de las moléculas de glucosa presentes en los fluidos del hospedero mamífero (297). Sin embargo, a pesar de que la mitocondria de los tripomastigotes es prácticamente inactiva y su única función se relaciona con la reoxidación del glicerol 3 fosfato derivado del glicosoma (298) (orgánulo donde se realizan los 6 primeros pasos de la glicolisis), se ha observado que algunos transcritos mitocondriales también sufren edición. Por ejemplo, los transcritos para las proteínas ND7 y ND8 se editan principalmente en tripomastigotes, mientras que los mensajeros para la subunidad II de la citocromo oxidasa (COII) y citocromo b (Cyb) son editados en su gran mayoría en formas procíclicas y, otros transcritos como los correspondientes a las proteínas COIII y ATPasa 6, son editados por igual en ambas formas del parásito (299). De interés, la mayor abundancia de los transcritos editados de ND3, ND7 y ND8 en las formas sanguíneas, parece estar implicada en la regeneración de NAD + (264). En Leishmania, por su parte, se conoce que en su paso por el vector, el parásito también obtiene su energía a partir de la fosforilación oxidativa de aa como la prolina y de la glicolisis, realizada en el glicosoma, (los promastigotes tienen un mayor número de glicosomas/célula). Sin embargo, en el hospedero mamífero, el parásito debe lidiar con el ambiente ácido de la vacuola parásitofora, en donde mientras la glucosa escasea, los aa son abundantes, así, se ha visto que la - oxidación de ácidos grasos es primordial para el amastigote (300). De hecho, estudios de Rosenzweig y colaboradores (2008), analizando el proteoma de L. (L.) donovani en 7 momentos durante su diferenciación de promastigote a amastigote, muestran como la capacidad glicolítica va disminuyendo mientras que la - oxidación, el catabolismo de aa, el ciclo del ácido tricarboxilico, la cadena respiratoria mitocondria y la fosforilación oxidativa, aumentan en el estadio de amastigote (300). Así, a diferencia de T. brucei, en L. (L.) donovani se encontró que la fosforilación oxidativa es activa en ambos estadios del parásito, produciendo aumento de sus proteínas 1,7 veces en amastigotes. Por otro lado, la 199

200 DISCUSIÓN GENERAL edición del ARNm ha sido principalmente estudiada en la forma promastigote del parásito de la especie L. tarentolae (288), L. (L.) mexicana amazonensis (15) y en formas promastigotes y amastigotes de L. (L.) donovani (16). Dentro del anterior contexto, para determinar si el transcrito del gen ND8 de L. (V.) braziliensis puede sufrir edición, se hizo un alineamiento manual entre la secuencia pre-editada de 270 nt, codificada en el maxicírculo y, la secuencia de 349 nt derivada del clon 600D (figura 1, artículo No. 4). En este alineamiento, se observaron múltiples inserciones y deleciones de residuos de uridina, sugiriendo un extensivo patrón de edición entre los nucleótidos 156 a 301, con la adición de 81 residuos de uridina y la remoción de 20 (255). Dado que al traducir la secuencia editada del clon 600D en todos los marcos de lectura posibles, se producían codones de parada, se procedió a explorar la posibilidad de que el clon 600D fuera un transcrito parcialmente editado, para ello, en primer lugar se alinearon la secuencia pre-editada o encriptada del maxicírculo de L. (V.) braziliensis con la secuencia editada del gen ND8 de L. tarentolae, encontrándose que el proceso de edición podía extenderse en sentido 3 5 para generar un transcrito correcto y funcional del gen ND8 (figura 3, articulo 4). Así, al alinear la secuencia hipotética de 145 aa derivada de la edición completa del gen ND8 con la secuencia de la proteína ND8 de L. tarentolae y L. (L.) amazonensis, se observó un 93% de identidad. En segundo lugar, con base en los primeros nt del gen ND8 (no sufren edición) y los últimos del transcrito parcialmente editado, se diseñaron oligonucleótidos e hicieron ensayos de RT-PCR, encontrándose cuatro clones adicionales, los cuales al igual que el clon 600D, tenían patrones erráticos e incompletos del gen ND8. Hallazgo que está de acuerdo con observaciones previas que indican la coexistencia de formas parcialmente y completamente editadas (301). Finalmente, para descartar la presencia de transcritos totalmente editados del gen ND8 en la cepa estudiada de L. (V.) braziliensis que debido a su baja abundancia no pudieran haber sido aislados por la técnica anterior, se buscó detectar transcritos de tamaños de 500 a 550 b que hibridarán con la sonda 200

201 DISCUSIÓN GENERAL derivada del clon 600D, demostrando la presencia de un transcrito totalmente editado. Los resultados del Northern blot evidenciaron los transcritos del gen ND8 de L. (V.) braziliensis con un tamaño de 300 a 400 b demostrándose la ausencia de un patrón completo de edición para este gen en promastigotes de la cepa M29-04 de L. (V.) braziliensis. Previamente, Souza y colaboradores (1992) habían observado la falta de transcritos de ND8 completamente editados tanto en promastigotes de L. tarentolae como en promastigotes de L. (L.) mexicana (264), estando estos transcritos solamente editados en su extremo 3, similar a lo observado en este estudio para el caso de promastigotes de L. (V.) braziliensis y lo encontrado en el caso de L. (L.) donovani (16). Sin embargo, no se puede descartar la presencia de transcritos totalmente editados y funcionales que por su baja abundancia en conjunto con las estrategias de búsqueda utilizadas no hayan podido ser detectados en los diferentes estadios analizados. El medio de cultivo para Leishmania es rico en azúcares y éstos son la principal fuente de energía que explota el parásito. Ya que el gen ND8 está relacionado con el metabolismo de óxido-reducción, es posible que bajo estas condiciones de crecimiento, la proteína respectiva no sea crítica para el desarrollo de L. (V.) braziliensis y en ausencia de presión selectiva, el parásito puede prescindir de la producción de transcritos correctamente editados. Este fenómeno, de pérdida de la capacidad de edición del ARNm observado frecuentemente en cepas mantenidas en laboratorio por largos periodos de tiempo (16, 288), se ha relacionado con la pérdida de los minicírculos y por tanto de los respectivos ARNg. Sin embargo, en la cepa LV78 de L. (L.) mexicana amazonensis, que también ha sido mantenida por un largo periodo de tiempo en cultivo, se ha encontrado la presencia de transcritos totalmente editados del gen ND8 (15). Llamativamente, reportes recientes indican la existencia de mecanismos de edición alternativos responsables de generar diversidad proteica (ya sea por la creación de marcos de lectura extendidos, sustitución de aa en la secuencia canónica mitocondrial u ORF más cortos) o afectar la región UTR de los transcritos (302). Es más, entre los 201

202 DISCUSIÓN GENERAL transcritos que sufren este fenómeno se encuentran los codificados por el gen ND8. Particularmente, en formas procíclicas de T. brucei, se han encontrado dos transcritos con ORF diferentes pero de tamaño similar. El denominado ORF1 que inicia con un residuo de leucina (UUG), 21 nt corriente abajo del AUG canónico y termina con el codón UAA creado por edición alternativa, luego de 117 aa. Al comparar con distintas bases de datos no se observó similaridad con alguna secuencia conocida. Por su parte, el ORF2 comienza 47 nt corriente abajo del AUG de inicio con un residuo de valina (GUG), termina con el codón UAA presente en la cola de poli(a) y codifica para 121 aa. Este ORF2 tiene una similaridad débil con una proteína hipotética de Plasmodium chabaudi (XP_744827). De forma importante, para cada uno de estos ORF se encontró al menos un ARNg involucrado en la edición alternativa. Teniendo en cuenta lo anterior, es posible que el transcrito ND8 encontrado en promastigotes de L. (V.) braziliensis en este estudio, sea producto de un mecanismo de edición alternativa, enmascarado por el uso de codones de inicio y parada no canónicos. También, es importante adicionar que dado que las señales de hibridación del transcrito ND8 no sufren ningún cambio de intensidad en respuesta a cambios de temperatura de 26 a 35 C, es posible pensar que tanto en promastigotes como en amastigotes, la edición de los transcritos del gen ND8 es parcial y, se concentra en el extremo 3 de la molécula. 202

203 DISCUSIÓN GENERAL 8.3 Regulación de la expresión génica y factores proteicos asociados a las UTR de los genes HSP70 de L. (V.) braziliensis El estrés térmico es un evento natural en el ciclo de vida de los parásitos del genero Leishmania (303). La transmisión desde el insecto vector poiquilotermo (26ºC) al hospedero mamífero homeotermo (35 a 37ºC) implica un aumento drástico de temperatura (218, 230). Lo anterior, representa un problema desafiante para la sobrevivencia de los organismos (304), pues el estrés térmico tiene impacto sobre muchos procesos celulares esenciales, afectando principalmente la funcionalidad de las proteínas, ya que éstas tienden a denaturarse en respuesta a los aumentos de temperatura. Para prevenir estos efectos adversos, en el parásito se desencadena la respuesta al choque térmico (218, 230), la cual consiste en la activación de vías de señalización celular que conllevan al aumento de la expresión de las proteínas de choque térmico (HSP) (230). En la mayoría de los eucariotas, el aumento en la expresión de las HSP durante el choque térmico, es el resultado de la activación transcripcional de los genes que codifican para dichas proteínas (305). Sin embargo, la expresión génica en los organismos de la familia Trypanosomatidae, es regulada a través de mecanismos post-transcripcionales, pues los genes son transcritos de manera constitutiva en forma de policistrones que deben ser madurados a través de los procesos acoplados de trans-splicing y poliadenilación (11, 13, 20, 306). La expresión de los genes que codifican para proteínas en estos parásitos, es controlada por la interacción entre motivos reguladores (cis-elementos) situados principalmente en las regiones 5 y 3 UTR y proteínas de unión a ARN (RBP o trans-elementos). Por lo tanto, las interacciones específicas entre trans y ciselementos están involucradas en el control de la maduración de los pre-arnm, el transporte, la estabilidad, el destino intracelular y la eficiencia de la traducción del ARNm (11, 13, 20, 306, 307). 203

204 DISCUSIÓN GENERAL Dentro del anterior contexto, en este trabajo, se propuso la identificación de proteínas de unión a las regiones 5 y 3 UTR (I y II) de los genes HSP70 de L. (V.) braziliensis, como una aproximación inicial al estudio de la regulación de la expresión de estos genes mediante la detección e identificación de proteínas que potencialmente interactúan con las UTR de los genes HSP70 de L. (V.) braziliensis y por ende pueden participar o gobernar la expresión de los genes HSP70. Así, mediante una estrategia en línea que incluía ensayos de pull down, electroforesis de proteínas en 2D y espectrometría de masas, se identificaron 52 proteínas diferentes que se clasificaron in silico en 9 grupos funcionales. La mayoría de las proteínas identificadas, como se esperaba, estaban relacionadas con el metabolismo del ARN (27%) y el proceso de traducción (7%). Entre estas, se aislaron proteínas previamente denominadas hipotéticas (por la falta de evidencia experimental de su expresión), relacionadas con el proceso de maduración de los pre-arnm. Por ejemplo, el análisis de la secuencia, el modelado de la estructura 3D ( y la predicción funcional in silico ( taskid=_notask) de la proteína LbrM , de unión a la región 3 UTR-II a 26 C, sugiere que ésta pertenece a la familia de proteínas con repeticiones ricas en leucina (LRR) (308) (Anexos sección 13.11). Estos motivos LRR, están presentes en fosfoproteínas U2A like (309), las cuales se unen con U2B para facilitar la interacción con el ARNnp U2 (ARN nuclear pequeño), promoviendo el ensamblaje del spliceosoma y la adición eficiente del complejo RNPnp U2 (Ribonucleoproteínas nucleares pequeñas) en el pre-arnm (310, 311). De hecho, la proteína LbrM tiene un 31% de identidad con la fosfoproteína U2A humana (PDB: 1a9na) (312). La proteína U2A fue identificada previamente en T. brucei (GenBank: CAA49552; Tb ) (313), sin embargo su ortólogo en L. (V.) braziliensis corresponde a un gen diferente (LbrM ), al que se aisló en este trabajo. Por lo anterior, se sugiere la posibilidad de que la proteína LbrM (LbU2A Like) participe junto con o remplazando a U2A en el procesamiento y maduración de los transcritos HSP70-II en L. (V.) braziliensis. 204

205 DISCUSIÓN GENERAL Llamativamente, estudios recientes de Kumar y colaboradores (2013) indican que formas basales del splicing como U2AF35, U2AFA65 y SF1, además de participar en la maduración de ciertos transcritos, también participan en la estabilidad de los respectivos ARN mensajeros (314). La proteína LbrM , se obtuvo en asociación con la región 5 UTR a 26 C y pertenece a la familia de proteínas con repeticiones WD40 (repeticiones triptófano-aspartato) (315) (Anexos sección 13.11). Estas proteínas con repeticiones WD abarcan un amplio espectro de funciones entre éstas (316): procesamiento de ARN como componente de partículas RNPsn (317, 318), el ensamblaje del citoesqueleto (319, 320), regulación de la formación de vesículas (321), intervención en vías de señalización (322) y control de varios aspectos de la división celular (323). No se encontró un ortólogo de función conocida para el gen LbrM , presentando solo un 14% de identidad con la proteína Prp19 de S. cerevisiae (PDB: 3lrvA) (317), la cual participa en la estabilización de la asociación de U5 y U6 con el spliceosoma (324), promoviendo interacciones específicas con varias bases del pre-arnm (325). Está proteína en T. brucei corresponde al gen Tb (310) y su ortólogo en L. (V.) braziliensis es el gen LbrM , el cual no tiene relación en secuencia con el gen que fue aislado en este trabajo (LbrM ). Dado el amplio espectro de procesos en los que pueden participar las proteínas de la familia WD40 y la poca información disponible, no es posible inferir in silico una función particular para esta proteína. El genoma de Leishmania codifica tres proteínas de unión a poli (A): LbPABP1, LbPABP2 y LbPABP3, pero sólo las dos primeras se conservan en las especies del genero Trypanosoma (326). Las PABP se unen a las colas poli (A) del ARNm recién sintetizado o maduro y parecen actuar en pasos específicos de la poliadenilación, el transporte, la traducción y la estabilidad de los ARNm a los que están unidas, aparentemente actuando como antagonistas de la unión de factores que intervienen en la degradación del ARNm (327). La proteína LbPABP2 (LbrM ) se encontró asociada a 26 C a las regiones 3 UTR-I y II, mientras 205

206 DISCUSIÓN GENERAL que la proteína LbPABP3 (LbrM ), solo se encontró asociada a la región 3 UTR-I a la misma temperatura. En Leishmania, mientras PABP2 realiza funciones no redundantes y esenciales para la supervivencia celular, PABP3 actúa de forma redundante con PABP2 o es necesaria para complementar su función (326). Curiosamente, en C. fasciculata, el ortólogo de PABP2 se ha encontrado formando parte de un complejo que reconoce elementos en las regiones no traducidas de los ARNm que se acumulan periódicamente durante el ciclo celular (328). Así, es posible que LbPABP2 a 26 C participe en la poliadenilación, el procesamiento o el exporte de ambos mensajeros (I y II) al citoplasma (326), mientras que LbPABP3 podría estar involucrada en la traducción del mensajero HSP70-I a 26 C. Unida a la 3 UTR-II a 26 C, se encontró la proteína LbrM Análisis in silico sugieren la presencia de 7 hélices trans-membrana (S1, 6-35; S2, 45-67; S3, ; S4, ; S5, ; S6, ; S7, ). El extremo amino de esta proteína está relacionado con el factor de transporte nuclear NTF2 (PDB: 3ujmB) (329) y hacia el extremo carboxilo de la secuencia hay un motivo de reconocimiento de ARN (RRM), similar al que se encuentra en la PABP2 de Xenopus laevis (PDB: 2JWN) (330) (Anexos sección 13.11). Otra proteína nuclear identificada en asociación con todas las regiones UTR, fue la LbRPA1 (LbrM ). Esta proteína contiene motivos de unión a ADN/ARN (331) y un sitio de unión a zinc que frecuentemente se relaciona con proteínas de unión a ARN (332). Es posible que estas dos proteínas nucleares participen en la articulación del proceso de transporte de estos mensajeros desde el núcleo hasta el citoplasma. Otra proteína, aparentemente relacionada con el proceso de cis-splicing según los resultados argumentados por el programa PANTHER ( fue la proteína LbrM El análisis in silico sugiere que guarda similitud con el componente Rpp25/Pop6 del complejo ARNasa P/MRP ( ), encargado del procesamiento y generación de moléculas funcionales de ARNt y ARNr (333, 336), que contiene dominios de 206

207 DISCUSIÓN GENERAL proteínas de la familia Alba (por su sigla en inglés, acetylation lowers binding affinity) (334, 337). Los miembros de la familia Alba son proteínas de unión a ADN o ARN de bacterias y eucariotas, que participan en el metabolismo del ARN (334). En T. brucei, se han identificado 4 proteínas de la familia alba (Alba 1-4) que a pesar de su homología con componentes del complejo ARNasa P no participan de su función y a diferencia de este complejo, se localizan en el citoplasma e interactúan con la maquinaria de traducción. Las proteínas Alba3/Alba4 (Tb , Tb ) tienen una elevada similitud (338) y su ortólogo en L. (V.) braziliensis es el gen LbrM , identificado en este trabajo en asociación con la región 5 UTR a 26 C. Se ha observado en T. brucei que la privación de nutrientes, induce la concentración de las proteínas Alba en gránulos de estrés citoplasmáticos junto a ARN poliadenilados. Así, mediante copurificación, se demostró que Alba3 interactúa con PABP1, PABP2 y eif4e4 (factor 4E de iniciación de la traducción) mientras que Alba4 interactúa con PABP1, PABP2, eif4g3 (factor 4G de iniciación de la traducción), eif4a1 (factor 4A de iniciación de la traducción) y eef1 (factor de elongación 1 ) (338). Adicionalmente, en Plasmodium berghei se encontró que las proteínas Alba copurifican con DHH1 y SCD6, proteínas que también se localizan en los cuerpos P del citoplasma (339). En T. brucei, se observó que las proteínas Alba3 y 4 colocalizan en gránulos de estrés en el citoplasma en conjunto con DHH1, cuando los parásitos son privados de nutrientes, pero no, cuando éstos son sometidos a estrés térmico. Además, se sugiere que éstas proteínas cumplen un papel importante en la reorganización del citoesqueleto y la transformación de formas procíclicas a tripomastigotes (340). Teniendo en cuenta lo anterior, la proteína LbrM , postulada aquí como LbAlba3/4, podría ejercer su función de forma concertada con un factor proteico asociado a la 3 UTR-II, para inducir silenciamiento de los transcritos HSP70-II a 26 C. Lo anterior implicaría que la abundancia de estas proteínas debe disminuir drásticamente en respuesta al choque térmico, para permitir que los transcritos HSP70-II sean traducidos bajo condiciones de estrés. 207

208 DISCUSIÓN GENERAL Los cambios conformacionales en los complejos que contienen ARN desempeñan un papel crítico en el metabolismo del ARN. Las helicasas de ARN de la familia DEAD-box promueven estos cambios a través de mecanismos dependientes de ATP que desenrollan los dúplex de ARN o interrumpen las interacciones ARN-proteína (341). Una proteína perteneciente a la familia DEADbox, el homólogo del factor de iniciación eucariótico 4A (LbrM ; LbIF4A1) de L. (V.) braziliensis, se encontró unida específicamente a la región 3 UTR-I de los genes HSP70 de L. (V.) braziliensis a 26 C. IF4A junto a IF4E interactúan con IF4G para dar origen al complejo IF4F, el cual se une al ARNm a través de la estructura cap y junto con otros factores de iniciación contribuye con el reclutamiento de la subunidad ribosomal pequeña (342). En promastigotes de L. (L.) major, LmEIF4A1 es una proteína muy abundante que tiene actividades ATPasa dependiente de ARN y ARN helicasa bidireccional (343) y su interacción con eif4g de L. (L.) infantum o L. (L.) major durante el proceso de traducción ha sido confirmada (344). Por lo anterior, se sugiere que la proteína LbIF4A1 interviene a 26 C agilizando la iniciación de la traducción de los mensajeros HSP70-I en el estadio promastigote de L. (V.) braziliensis. Otras ARN helicasas putativas identificadas en este trabajo, fueron la LbrM , denominada aquí LbDed1, tiene una identidad del 42,5% con la proteína completa Ded1 de S. cerevisiae (345). LbDed1 fue identificada en los ensayos de pull down con todas las regiones UTR a 26 C. La segunda proteína, LbrM , se encontró asociada tanto a la región 5 UTR como a la 3 UTR-II a 26 C. Esta proteína tiene 37,8% de identidad en 604-residuos de su C-terminal con Ded1, motivo por el cual se le denomino LbDed1Like (346). La sobreexpresión de Ded1 inhibe la traducción conduciendo a la acumulación de ribonucleoproteínas en los cuerpos P o en los gránulos de estrés (345, 347). Por otro lado, extractos de levadura en los que Ded1 se ha suprimido en un 80%, presentan una reducción de la traducción y esta puede ser recuperada por la adición de Ded1 recombinante, observándose que la facultad de promover o 208

209 DISCUSIÓN GENERAL favorecer la traducción es dependiente de la actividad ATPasa de Ded1 y de la concentración de ATP celular (347). Los anteriores indicios permiten postular que estas helicasas ejercen un control sobre la traducción de los ARNm de los genes HSP70 de L. (V.) braziliensis, cuyo efecto, seguramente, es dependiente de la concentración de ATP. Un papel adicional para la proteína LbDed1Like podría ser la inhibición de la traducción de los mensajeros HSP70-II a 26 C. Unida a la región 5 UTR a 26 C, se encontró una proteína putativa relacionada con la subunidad K del factor de iniciación 3 (LbrM ; LbIF3.K). En levaduras, el eif3 participa en el reclutamiento de algunos ARNm en la maquinaria de traducción, independientemente de la presencia de eif4g (348). Por otra parte, varias subunidades del eif3 tienen actividad de unión al ARN (348) y se ha propuesto que algunas de éstas podrían ayudar a reclutar subgrupos específicos de ARNm en condiciones de estrés (348). Aunque la subunidad eif3.k no ha sido encontrada en levaduras (349), la subunidad eif3.k de humano tiene el potencial de unirse al ARN por la presencia de un motivo hélice-giro-hélice (HTH), sugiriéndose que esta podría actuar como un andamio estructural propiciando interacciones proteína-proteína y proteína-arn (350). Así, es posible que esta subunidad esté promoviendo a 26 C el ensamblaje del complejo de iniciación de la traducción sobre el 5 de los mensajeros HSP70-I en promastigotes de L. (V.) braziliensis. Otro componente del complejo de iniciación de la traducción identificado unido específicamente a la 5 UTR a 26 C, fue el factor de iniciación 5 putativo (LbrM ; LbIF5). El eif5 es un colaborador importante del factor de iniciación 2 (eif2), modulando su función en varios pasos críticos durante el inicio de la traducción (351). También, se identificaron dos componentes del proceso de elongación de la traducción, 1). Como el factor de elongación 1 (LbrM ; LbEF1 ), que se encontró unido a la 5 UTR y 3 UTR-I a 26 C. Esta es una proteína abundante, que también participa en otros procesos celulares, como el transporte nuclear, el control de calidad de las proteínas y la degradación co- 209

210 DISCUSIÓN GENERAL traduccional, entre otros (352, 353) y 2). El factor de elongación 2 (LbrM ; LbEF2), que es conocido por su función en la translocación de los ribosomas a lo largo del ARNm durante el proceso de traducción (354, 355), fue aislado por su unión tanto a la 5 UTR como a la 3 UTR-II a 26 C. Esta proteína tiene un 61.3% y 61,4% de identidad con las proteínas de S. cerevisiae y humano, respectivamente. Por otra parte, mientras los cuerpos de procesamiento (cuerpos P) son gránulos citoplasmáticos donde se cree que ocurre la degradación (356, 357) y el silenciamiento traduccional del ARNm ( ), los gránulos de estrés (GS) son sitios donde se almacenan ARNm atascados en el inicio de la traducción y en condiciones de estrés celular. Así, los GS sirven como centros de priorización, donde se decide si determinados ARNm deben reiniciar su traducción o si deben ser degradados (358, 361). Los cuerpos P y los GS, además de interactuar entre sí (362, 363), comparten algunos de sus componentes. Sin embargo, la proteína SCD6 es específica de los cuerpos P (364), mientras que la subunidad pequeña ribosomal, el eif3 y las proteínas de unión a poli (A), son específicas de los GS ( ). La proteína LbrM (LbSCD6), encontrada en este estudio en asociación con la región 3 UTR-II a 26 C, posiblemente está involucrada en el silenciamiento de los mensajeros HSP70-II en el estadio promastigote del parásito. Otra de las proteínas llamativas identificada en este estudio, debido a su relación con el estrés celular fue la subunidad reguladora de la proteína fosfatasa 2A (LbrM ), aquí denominada LbPR64/A. Esta proteína, recuperada por su asociación con la 5 UTR a 26 C, pertenece a una familia de fosfatasas de serina y treonina que juegan papeles críticos en la regulación del ciclo celular, la morfología celular y el desarrollo (368). En células A-431 humanas, se ha reportado que la actividad de PP2A aumenta cuando la HSP70 se sobreexpresa (369). En plantas, se ha sugerido que la PP2A está implicada en la respuesta de adaptación para contrarrestar el estrés por calor (370). Por otra parte, en T. cruzi, se ha encontrado que la PP2A es crucial para la transformación de tripomastigotes 210

211 DISCUSIÓN GENERAL en amastigotes (371). Por otro lado, se sabe que la acumulación de proteínas denaturadas en el retículo endoplasmático (RE) produce la liberación de la proteína quinasa del RE (PERK) hacia el citoplasma, donde esta proteína se encarga de fosforilar al eif2, induciendo inhibición generalizada de la traducción de proteínas (372). La actividad de PERK ha sido descrita en L. (L.) infantum (373) y se conoce que la fosforilación del eif2 además de regular la traducción de forma negativa, también se relaciona con el proceso de diferenciación del parásito (374). Teniendo en cuenta los hallazgos de este estudio, se propone que la holoenzima se ensambla a 26 C sobre la 5 UTR de los mensajeros HSP70-I y II. En el caso de los ARNm HSP70-I, promueve la traducción al mantener desfosforilado el eif2. Por su parte, en el caso de los ARNm HSP70-II a 26 C, se propone que la existencia de proteínas silenciadoras de la traducción específicamente unidas a la región 3 UTR-II a 26 C, inhibiendo la traducción de los genes HSP70-II, al bloquear el correcto ensamblaje del complejo de iniciación de la traducción. Este planteamiento se soporta en el modelo de circularización del mensajero durante la traducción, el cual sugiere la interacción entre proteínas que están unidas a las regiones 5 y 3 UTR (Figura 16) (375, 376). Si bien en los ensayos de pull down LbPR64/A no fue detectada a 35 C, es posible que esto se debiera a que a esta temperatura la tasa de traducción es inferior y la concentración de proteína este por debajo del límite de detección del ensayo utilizado. Por otra parte, la propia proteína HSP70 fue identificada en asociación con la región 5 UTR a 26 C y la 3 UTR-I y II a 35 C. En línea con la evidencia anterior, se ha reportado que la sobre expresión de la proteína HSP70 inhibe la actividad de la PKC (Proteína quinasa C) y promueve la activación de fosfatasas (369). Como se ha demostrado para algunas proteínas en tripanosomátidos, es posible que la proteína HSP70 pueda ser responsable de su propia regulación a través de la interacción con sus UTR por un mecanismo de autorregulación (249). De hecho, en ensayos de EMSA (por su sigla en inglés: Electrophoretic Mobility Shift Assay) 211

212 DISCUSIÓN GENERAL utilizando la proteína HSP70 humana (identidad de 69,8% con la L. (V.) braziliensis), se demostró que esta proteína se une directa y específicamente a sustratos de ARN ricos en U, como los elementos ricos en AU (ARE) (377). Aún más, se ha encontrado que la proteína HSP70 humana también une y estabiliza mensajeros que contienen elementos ARE (378). En consonancia con los reportes anteriores, se observó que hay varios tramos ricos en U con similitud a elementos ARE dentro de la región 3 UTR-II de los genes HSP70 de L. (V.) braziliensis (282). Por lo tanto, teniendo la información anterior como base, se postula que la asociación de la proteína HSP70 con la región 3 UTR-I y II, promueve la desfosforilación del eif2 favoreciendo así la traducción activa de los mensajeros HSP70-I y II a 35 C. Figura 16. Modelo de circularización del mensajero durante el proceso de traducción, promovido por la interacción entre proteínas que se unen a las regiones 3 y 5 UTR, modificado de referencia (11). La proteína LbrM , con afinidad por la región 5 UTR a 35 C, pertenece a la familia de proteínas con repeticiones WD40. Análisis in silico sugiere conservación de su estructura 3D con la proteína RACK1A (por su sigla en inglés receptor for activated C-kinase) de Arabidopsis thaliana (PDB: 3dm0A; UniProt: O24456) (379). RACK1A se expresa de forma ubicua y se ha implicado 212

213 DISCUSIÓN GENERAL en diversas vías de señalización (380), estrés celular (379, 381, 382) y la traducción de proteínas ( ). En células de mamífero, RACK1A interactúa en el citoplasma con el factor de iniciación 6 (eif6), el cual se encarga de mantener las subunidades 40S y 60S disociadas in vitro e in vivo se ha asociado a la subunidad 60S pero no a la 80S. Por su parte, RACK1A se encontró asociada in vivo con la subunidad 60S, ribosomas (80S), polisomas, citoesqueleto y como proteína libre (384). Se ha sugerido que RACK1A junto a la PKC (LbrM , encontrada en asociación con la región 3 UTR-I a 35 C), ejercen un efecto estimulador sobre la traducción a través de un mecanismo que induce la disociación del complejo eif6/60s por la fosforilación del eif6 en su residuo de serina 235 (384). En Schizosaccharomyces pombe, se encontró que RACK1A se asocia a polisomas y a la subunidad 40S promoviendo la eficiencia de la traducción (385). La información expuesta previamente, permite sugerir que las proteínas ortólogas de RACK1A (LbrM ; LbRACK1A) y PKC (LbrM ; LbPKC), de L. (V.) braziliensis posiblemente actúen promoviendo la traducción de los mensajeros HSP70-I y II a 35 C, mediante la interacción de LbRACK1A con eif6 y la fosforilación de eif6 por LbPKC, que en conjunto previenen el secuestro de la subunidad 60S ribosomal por parte del eif6. El segundo grupo más abundante de proteínas encontradas en este estudio, está relacionado con el metabolismo energético (21%), seguido por el metabolismo de proteínas (19%). Estos fueron resultados inesperados, ya que estas proteínas citoplasmáticas no poseen motivos de reconocimiento de ARN o dominios de unión a ARN en sus estructuras. Sin embargo, en S. cerevisiae y otros organismos, algunas de las enzimas metabólicas conocidas como moonlight (enzimas que en sitios diferentes a la localización en que cumplen su actividad enzimática habitual, pueden llevar a cabo funciones diferentes), son capaces de unirse a secuencias de ARN ( ). Algunos ejemplos de proteínas moonlight en tripanosomátidos son la enolasa de L. (L.) mexicana (390, 391) y la hexoquinasa 2 de T. brucei (392). 213

214 DISCUSIÓN GENERAL Otro tipo de proteínas que aparentemente no tienen relación con la regulación de la expresión de los genes HSP70, fue por ejemplo una proteína mitocondrial de unión a ARN (LbrM ), identificada en asociación con las regiones 5 a 26 C y 3 UTR-I a 35 C. Esta proteína, reportada originalmente en L. tarentolae, es capaz de unirse a ARN de cadena sencilla y doble y se ha visto que promueve la estabilización de transcritos mitocondriales en T. brucei (393). Sin embargo, la asociación de ésta proteína a las UTR de la HSP70 de L. (V.) braziliensis puede deberse a que durante el proceso de lisis del parásito, se liberaron proteínas mitocondriales. También, se identificaron la -tubulina (LbrM ) y la -tubulina (LbrM ), componentes fundamentales de los microtúbulos. Estas se encontraron asociadas específicamente a la 5 UTR a 26 C. En principio, su aparición en asociación con las UTR puede deberse a ruido de fondo del ensayo, dado que estas son proteínas abundantes en el citoplasma. Sin embargo, evidencias recientes sugieren que el citoesqueleto participa en la organización espacial y la regulación de la traducción (237). Por tanto, estas proteínas también pueden participar en la regulación de la expresión de los genes HSP70, tal vez a través de la localización mensajeros en puntos de la célula que favorecen su traducción. Para dar un breve resumen de los hallazgos de este estudio, a continuación, se propone un modelo que intenta explicar las interacciones entre las proteínas identificadas y las regiones UTR, que podrían orquestar la regulación de los genes HSP70 de L. (V.) braziliensis. En las etapas iniciales, se propone que la proteína LbU2A Like (LbrM ) afectaría la eficiencia de la maduración de los transcritos HSP70-II a 26 C y la proteína LbrM intervendría en el transporte de los mensajeros HSP70-II del núcleo al citoplasma. De manera interesante, la ausencia de interacción de la LbPABP3 con los mensajeros HSP70-II pero si con los HSP70-I, 214

215 DISCUSIÓN GENERAL puede proporcionar una ventaja frente a los procesos de maduración y transporte de los transcritos HSP70-I (figura 17). Para entender si la función de estas proteínas es retrasar la maduración y el transporte de los ARNm HSP70-II a 26 C o por el contrario, agilizar estos procesos en los mensajeros HSP70-I, en principio se necesita conocer la localización que tienen estas proteínas en el parásito y si co-localizan con ARNm maduros o intermediarios de la HSP70-I o HSP70-II. 215

216 DISCUSIÓN GENERAL HSP70-II ARN policistrónico HSP70-I HSP70-I LbU2A Like LbPABP 2 LbPABP 3 LbrM LbRPA1 Figura 17. Modelo que propone la interacción de algunas de las proteínas detectadas con los transcritos de los genes HSP70 de L. (V.) braziliensis durante el proceso de maduración y el transporte de los transcritos desde el núcleo al citoplasma. 216

217 DISCUSIÓN GENERAL Traducción ATP + + = Activación traduccional H70 LbEF-1 LbIF5 LbDed1 LbSCD6 SCD6 LbEF-2 LbPABP 2 LbHSP70 H70 LbIF3.k LbDed1 like Cuerpos de procesamiento ATP + + = Silenciamiento traduccional LbPR64/A LbAlba3/4 LbIF4A Lb / tubulinas 60S 40S Degradación del ARNm Desconocido Figura 18. Modelo propuesto para la interacción de las proteínas detectadas con las UTR de los transcritos HSP70-I a 26 C. Los transcritos HSP70-I reclutan múltiples factores de iniciación de la traducción tales como el LbIF3.K, LbIF4A y LbIF5, como también los factores de elongación LbEF1 y LbEF2, sugiriendo que a 26 C estos transcritos son capaces también de reclutar las subunidades 40S y 60S para ser traducidos activamente. Un hallazgo interesante fue la presencia de dos proteínas relacionadas con la helicasa de ARN de S. cerevisiae Ded1 (LbrM : LbDed1; LbrM : LbDed1Like). Para contribuir con la homeostasis, en medios ricos en nutrientes a 26 C donde el parásito tiene una alta concentración de ATP, la proteína LbDed1 estaría favoreciendo la traducción de los transcritos HSP70-I y II (figura 18, panel superior) (345, 347). Sin embargo, cuando los genes HSP70-II se encuentran 217

218 DISCUSIÓN GENERAL silenciados, este silenciamiento no permite su traducción. En condiciones de estrés nutricional a 26 C en donde hay bajas concentraciones de ATP, LbDed1 tendría una actividad helicasa limitada (figura 18, panel inferior) (347). En relación a la helicasa LbDed1Like, dado que tienen una identidad de solo el 42,4% en su extremo carboxilo con LbDed1 y tiene una extensión adicional de 280 aa en comparación a LbDed1, se sugiere que puede actuar de forma diferente. Así, se propone que esta helicasa participa en la inhibición de la traducción de los mensajeros HSP70-II a 26 C. La proteína LbrM (LbAlba3/4) también estaría involucrada en el silenciamiento traduccional de los mensajeros HSP70-I a 26 C a bajas concentraciones fisiológicas de ATP, pues como se mencionó previamente, en T. brucei esta proteína se localiza en GS cuando el parásito es privado de nutrientes (338) (figura 18, panel inferior). Cuerpos de procesamiento LbEF-1 LbEF-2 H70 SCD6 LbIF5 LbDed1 LbPABP 2 LbHSP70 H70 Interacción? SCD6 = silenciamiento traduccional? LbSCD6 SCD6 LbIF3.k LbDed1 like LbPR64/A LbAlba3/4 Lb / tubulinas Degradación del ARNm Desconocido Figura 19. Modelo propuesto para la interacción de las proteínas detectadas con las UTR de los transcritos HSP70-II a 26 C. Aunque los mensajeros HSP70-II exhiben similar capacidad que los HSP70-I para reclutar los factores de iniciación (a excepción de LbIF4A) y de elongación de la traducción, es posible que la interacción entre LbAlba3/4 y LbSCD6 218

219 DISCUSIÓN GENERAL (LbrM ) actué como represor de la traducción de los mensajeros HSP70-II a 26 C (figura 19, panel superior). Una interacción de este tipo fue observada previamente en P. berghei (339). De manera interesante, se observó que la misma proteína HSP70 (LbrM ) y una subunidad reguladora de la PP2A (LbrM : LbPR64/A), se asocian a la 5 UTR de los genes HSP70 (figuras 18 y 19, panel superior). Una posible función para estas dos proteínas es el aumento de la síntesis proteica a partir de los transcritos traduccionalmente activos (HSP70-I), a través de la modulación de las actividades fosfatasa/quinasa (369), que favorecen la desfosforilación de factores de iniciación de la traducción como el eif2 y estimulan así la traducción ( ). Aunque no se encontraron enzimas directamente relacionadas con el catabolismo del ARN, no se puede descartar cierto nivel de degradación para mantener la homeostasis celular, aunque el equilibrio puede estar inclinado hacia la traducción (HSP70-I) o el silenciamiento (HSP70-I y HSP70-II) de estos mensajeros a 26 C (figuras 18 y 19, panel inferior). La unión de LbRACK1A (LbrM ) a la 5 UTR de los mensajeros HSP70 contribuye a reclutar la subunidad 40S, para iniciar la traducción en condiciones de choque térmico (35 C). Esta proteína también se une al eif6, evitando que este factor secuestre a la subunidad 60S ribosomal y por lo tanto favorece la traducción de ambos mensajeros (HSP70-I y HSP70-II) a 35 C (figuras 20 y 21). Por otro lado, aunque en este estudio no se encontró la PP2A interactuando a 35 C con los ARNm de los genes HSP70, no se puede descartar su presencia y en tal caso, la holoenzima actuaría desfosforilando el eif2 para promover la traducción de los mensajeros HSP70 (Figuras 20 y 21). La enzima LbPKC (LbrM ) se une a los transcritos HSP70-I y estaría asociada a la fosforilación del eif6 promoviendo su disociación de la subunidad 60S ribosomal en cercanías al mensajero HSP70-I para estimular su traducción a 35 C (figura 20). Finalmente, la proteína HSP70 puede estar regulando la traducción de los 219

220 DISCUSIÓN GENERAL mensajeros HSP70-I y II a 35 C mediante la modulación de las quinasas y fosfatasas (figura 21) (369). 220

221 DISCUSIÓN GENERAL Gránulos de estrés Traducción Cuerpos de procesamiento Polisomas Degradación del ARNm? H70 H70 H70 H70 Proteína sintetizada LbPKC LbRACK1A eif6 eif2 fosforilado Holoenzima PP2A 60S 40S eif6 fosforilado eif2 Desconocido Figura 20. Modelo propuesto para la interacción de las proteínas detectadas con las UTR de los transcritos HSP70-I a 35 C. 221

222 DISCUSIÓN GENERAL Gránulos de estrés? Traducción Cuerpos de procesamiento Polisomas H70 Degradación del ARNm? H70 H70 H70 H70 Proteína sintetizada LbHSP70 H70 LbRACK1A eif6 eif2 fosforilado Holoenzima PP2A 60S 40S eif6 fosforilado eif2 Desconocido Figura 21. Modelo propuesto para la interacción de las proteínas detectadas con las UTR de los transcritos HSP70- II a 35 C. 222

223 DISCUSIÓN GENERAL Finalmente, para corroborar las interacciones ARN/proteína descritas en este trabajo, es necesario hacer estudios adicionales que proporcionen información del momento y localización específica en que ocurren estas interacciones en el parásito, para contribuir al a entendimiento de su importancia en la regulación de la expresión de los genes HSP70 y por lo tanto, en la biología y la patología causada por L. (V.) braziliensis. En el futuro, este conocimiento puede ser valioso para el diseño racional de nuevas intervenciones terapéuticas. 223

224 PRINCIPALES HALLAZGOS 9. PRINCIPALES HALLAZGOS Los genes HSP70 y -tubulina de L. (V.) braziliensis se encuentran repetidos y se organizan en tándem. Hecho que probablemente responde a la necesidad de aumentar los niveles de expresión de estos genes. En L. (V.) braziliensis existen dos tipos de genes HSP70 y -tubulina, los cuales difieren en su extremo 3 UTR, potenciales cis-elementos, número de copias y posición dentro de la organización génica. Lo que posiblemente obedece a la necesidad de asegurar la expresión de la proteína bajo condiciones fisiológicas diferentes. El gen ND8 de L. (V.) braziliensis se localiza en el ADN mitocondrial del parásito, con igual posición y dirección de transcripción que sus ortólogos en tripanosomátidos. Se determinó la presencia de motivos diferentes en las regiones 3 UTR-I y II de los genes HSP70 y -tubulina de L. (V.) braziliensis. Motivos previamente reportados como cis-elementos que gobiernan la expresión de otros genes en tripanosomátidos. La existencia de estos potenciales cis-elementos en las regiones 3 UTR-I y II de los genes HSP70 y -tubulina de L. (V.) braziliensis, sugiere que éstos podrían participar en el control de la expresión de las proteínas HSP70 y -tubulina. A pesar de existir una mayor síntesis de novo de la proteína HSP70 a 35 C, los mensajeros HSP70-I y II no se acumulan en respuesta al choque térmico. Por tanto, la expresión de la proteína a 35 C se controla por mecanismos que operan a nivel traduccional o post-traduccional. 224

225 PRINCIPALES HALLAZGOS La disminución de los niveles de ARNm de la -tubulina en L. (V.) braziliensis frente al choque térmico, simula la diferenciación de promastigote a amastigote, en donde el parásito pasa de requerir una mayor a una menor cantidad de proteína -tubulina. Los mensajeros de la -tubulina de L. (V.) braziliensis disminuyen en respuesta al choque térmico, debido a la pérdida de estabilidad, mecanismo mediado por un factor proteico termo-sensible. Los transcritos del gen ND8 de L. (V.) braziliensis, al igual que los de sus ortólogos de otras especies de tripanosomátidos, necesitan ser extensivamente editados para dar lugar a la proteína mitocondrial funcional convencional. Sin embargo, solo se evidenció la presencia de transcritos parcialmente editados (en la región 3 ) en promatigotes de L. (V.) braziliensis. Es probable que los transcritos encontrados del gen ND8 en L. (V.) braziliensis sean el resultado de una edición alternativa para generar variantes proteicas o ARN no codificantes implicados en regulación. Este es el primer trabajo que identifica proteínas de unión a las regiones UTR de los genes HSP70 de Leishmania, combinando pull down, electroforesis en 2D y espectrometría de masas. Se reportó por primera vez la expresión de 37 proteínas del parásito L. (V.) braziliensis, previamente detectadas en otras especies. Se corroboró por primera vez la expresión de 9 proteínas hipotéticas del parásito L. (V.) braziliensis, 5 de las cuales presentan motivos de unión a ARN. 225

226 PRINCIPALES HALLAZGOS Se identificó un conjunto de proteínas que probablemente intervienen en distintos puntos de control de la expresión de los genes HSP70 de L. (V.) braziliensis como procesamiento del policistron, transporte al citoplasma, estabilidad y traducción de los mensajeros. El hallazgo de la proteína HSP70 interactuando con las UTR de sus propios mensajeros sugiere un mecanismo de autoregulación. Análisis bioinformáticos y de revisión de la literatura permitieron asignar funciones putativas a varias de las proteínas encontradas en la regulación de la expresión de los genes HSP70, como: LbU2A Like, LbrM , LbPABP3, LbAlba3/4, LbSCD6, LbDed1, LbDed1Like, LbRACK1A, LbPKC y LbHSP70, entre otras. 226

227 CONCLUSIONES 10. CONCLUSIONES Las características de la organización de los genes HSP70 y -tubulina de L. (V.) braziliensis (alto número de copias, ubicación en una sola agrupación y dos tipos de genes diferentes) se correlacionan con los altos niveles de expresión de las proteínas respectivas. La expresión de la proteína HSP70 de L. (V.) braziliensis se controla por mecanismos que operan a nivel traduccional. La expresión de la proteína -tubulina de L. (V.) braziliensis a 35 C se controla a través de la estabilidad de los mensajeros. Se reportó por primera vez la ocurrencia de edición del ARNm en L. (V.) braziliensis, una especie del subgénero Leishmania Viannia. La estrategia experimental utilizada en este estudio, permite el aislamiento de proteínas que interactúan con el ARN. 227

228 PERSPECTIVAS 11. PERSPECTIVAS Teniendo en cuenta los hallazgos de este trabajo, se plantean los siguientes interrogantes, los cuales pueden ser objeto de estudios futuros: Dada la importancia biológica de la transposición de copias de genes repetidos en tándem (para la diversificación de las señales y mecanismos de regulación de la expresión o la diversificación de la secuencia y por ende, de la función de la proteína) a otro locus del cromosoma (genes -tubulina de L. (L.) infantum) o incluso a un cromosoma diferente (genes -tubulina de L. (V.) braziliensis), se hace necesario confirmar el ensamblaje de los cromosomas respectivos en los proyectos genomas de ambas especies, con el fin de verificar la existencia de los genes LbrM , LbrM y LinJ y así estudiar, posteriormente, si estos son pseudogenes o por el contrario, codifican para proteínas diferentes de la -tubulina típica. Por otra parte, en relación a los genes ND8 quedan varios aspectos importantes por elucidar, tales como: determinar la existencia de edición canónica completa o alternativa, tanto en promastigotes como amastigotes de L. (V.) braziliensis y más importante aún, cuál es la función específica de los ARN o de las proteínas originadas en cada uno de los dos estadios principales del parásito. Con respecto a los genes -tubulina, sería muy importante delimitar la extensión de la región 3 UTR-II, con el fin de diferenciar mediante ensayos de Northern blot, usando como sonda las regiones divergentes entre ambas 3 UTR (I y II), los dos transcritos correspondientes y estudiar, posteriormente, los cis-elementos potenciales presentes en cada una de ellas y de ser posible, determinar las proteínas implicadas en la regulación de la expresión de estos genes, con miras a aportar conocimiento básico sobre los mecanismos de regulación y quizás, más adelante, posibles blancos terapéuticos. 228

229 PERSPECTIVAS En cuanto a los genes HSP70, en este trabajo, se elucidó la existencia de ambos tipos de genes (I y II), se determinaron las secuencias de las regiones 5 y 3 UTR, así como los cis-elementos potenciales en cada una de ellas, su expresión bajo condiciones de crecimiento normales y de choque térmico y finalmente, se identificaron las proteínas del parásito, que también bajo condiciones de crecimiento normales y de choque térmico interactúan con las regiones UTR, a fin de orquestar la regulación de la expresión de estos genes. Es decir, en otras palabras se caracterizaron los componentes potenciales de la regulación de la expresión de los genes HSP70 de L. (V.) braziliensis. Teniendo en cuenta que la técnica de pull down es una técnica de tamizaje, queda entonces por confirmar la interacción entre los distintos actores antes mencionados, así como determinar el papel biológico de los mismos. En el anterior sentido, el Laboratorio de Parasitología Molecular de la Pontifica Universidad Javeriana, en colaboración con el grupo de Regulación de la expresión génica en Leishmania, del Centro de Biología Molecular Severo Ochoa, están dando pasos en esta dirección, seleccionando, en principio, los genes LbrM y LbrM , los cuales fueron clonados y expresados para obtener las proteínas en condiciones nativas. De forma que, a mediano plazo, mediante ensayos de EMSA (por su sigla en inglés: Electrophoretic Mobility Shift Assay) y co-inmunoprecipitación, se espera verificar la interacción de las UTR de los genes HSP70 con estas proteínas y dependiendo de estos resultados se plantearán estudios funcionales, para elucidar la importancia de las mismas en la supervivencia o virulencia del parásito. Finalmente, valdría la pena extender el análisis de las proteínas o factores en trans que gobiernan la expresión de los genes HSP70 en otras especies de Leishmania. 229

230 12. REFERENCIAS 1. Banuls AL, Hide M, Prugnolle F. Leishmania and the leishmaniases: a parasite genetic update and advances in taxonomy, epidemiology and pathogenicity in humans. Advances in parasitology. 2007;64: Epub 2007/05/ Alvar J, Velez ID, Bern C, Herrero M, Desjeux P, Cano J, et al. Leishmaniasis worldwide and global estimates of its incidence. PloS one. 2012;7(5):e Epub 2012/06/ Oddone R, Schweynoch C, Schonian G, de Sousa Cdos S, Cupolillo E, Espinosa D, et al. Development of a multilocus microsatellite typing approach for discriminating strains of Leishmania (Viannia) species. Journal of clinical microbiology. 2009;47(9): Epub 2009/07/ Croft SL, Yardley V. Chemotherapy of leishmaniasis. Current pharmaceutical design. 2002;8(4): Epub 2002/02/ Berg M, Mannaert A, Vanaerschot M, G VDA, Dujardin JC. (Post-) Genomic approaches to tackle drug resistance in Leishmania. Parasitology. 2013:1-14. Epub 2013/03/ Croft SL, Sundar S, Fairlamb AH. Drug resistance in leishmaniasis. Clinical microbiology reviews. 2006;19(1): Epub 2006/01/ Croft SL, Seifert K, Yardley V. Current scenario of drug development for leishmaniasis. The Indian journal of medical research. 2006;123(3): Epub 2006/06/ Croft SL. Monitoring drug resistance in leishmaniasis. Tropical medicine & international health : TM & IH. 2001;6(11): Epub 2001/11/ Soto J, Toledo J, Gutierrez P, Nicholls RS, Padilla J, Engel J, et al. Treatment of American cutaneous leishmaniasis with miltefosine, an oral agent. Clinical infectious diseases : an official publication of the Infectious Diseases Society of America. 2001;33(7):E Epub 2001/08/ Zilberstein D, Shapira M. The role of ph and temperature in the development of Leishmania parasites. Annual review of microbiology. 1994;48: Epub 1994/01/ Clayton C, Shapira M. Post-transcriptional regulation of gene expression in trypanosomes and leishmanias. Molecular and biochemical parasitology. 2007;156(2): Epub 2007/09/ Martinez-Calvillo S, Vizuet-de-Rueda JC, Florencio-Martinez LE, Manning-Cela RG, Figueroa-Angulo EE. Gene expression in trypanosomatid parasites. Journal of biomedicine & biotechnology. 2010;2010: Epub 2010/02/ Clayton CE. Life without transcriptional control? From fly to man and back again. The EMBO journal. 2002;21(8): Epub 2002/04/ Folgueira C, Canavate C, Chicharro C, Requena JM. Genomic organization and expression of the HSP70 locus in New and Old World Leishmania species. Parasitology. 2007;134(Pt 3): Epub 2006/10/ Maslov DA. Complete set of mitochondrial pan-edited mrnas in Leishmania mexicana amazonensis LV78. Molecular and biochemical parasitology. 2010;173(2): Epub 2010/06/ Nebohacova M, Kim CE, Simpson L, Maslov DA. RNA editing and mitochondrial activity in promastigotes and amastigotes of Leishmania donovani. International journal for parasitology. 2009;39(6): Epub 2008/12/ Yatawara L, Le TH, Wickramasinghe S, Agatsuma T. Maxicircle (mitochondrial) genome sequence (partial) of Leishmania major: gene content, arrangement and composition compared with Leishmania tarentolae. Gene. 2008;424(1-2):80-6. Epub 2008/08/

231 18. Simpson L. The mitochondrial genome of kinetoplastid protozoa: genomic organization, transcription, replication, and evolution. Annual review of microbiology. 1987;41: Epub 1987/01/ de la Cruz VF, Neckelmann N, Simpson L. Sequences of six genes and several open reading frames in the kinetoplast maxicircle DNA of Leishmania tarentolae. The Journal of biological chemistry. 1984;259(24): Epub 1984/12/ Requena JM. Lights and shadows on gene organization and regulation of gene expression in Leishmania. Frontiers in bioscience : a journal and virtual library. 2011;16: Epub 2011/05/ Folgueira C, Carrion J, Moreno J, Saugar JM, Canavate C, Requena JM. Effects of the disruption of the HSP70-II gene on the growth, morphology, and virulence of Leishmania infantum promastigotes. International microbiology : the official journal of the Spanish Society for Microbiology. 2008;11(2):81-9. Epub 2008/07/ Carrion J, Folgueira C, Soto M, Fresno M, Requena JM. Leishmania infantum HSP70-II null mutant as candidate vaccine against leishmaniasis: a preliminary evaluation. Parasites & vectors. 2011;4:150. Epub 2011/07/ Grimaldi G, Jr., Tesh RB. Leishmaniases of the New World: current concepts and implications for future research. Clinical microbiology reviews. 1993;6(3): Epub 1993/07/ Murray HW, Berman JD, Davies CR, Saravia NG. Advances in leishmaniasis. Lancet. 2005;366(9496): Epub 2005/11/ Reithinger R, Dujardin JC, Louzir H, Pirmez C, Alexander B, Brooker S. Cutaneous leishmaniasis. The Lancet infectious diseases. 2007;7(9): Epub 2007/08/ Control of the leishmaniases. World Health Organization technical report series. 2010(949):xii-xiii, 1-186, back cover. Epub 2010/01/ Desjeux P. Leishmaniasis: current situation and new perspectives. Comparative immunology, microbiology and infectious diseases. 2004;27(5): Epub 2004/07/ Goto H, Lindoso JA. Current diagnosis and treatment of cutaneous and mucocutaneous leishmaniasis. Expert review of anti-infective therapy. 2010;8(4): Epub 2010/04/ Sanchez-Tejeda G, Rodriguez N, Parra CI, Hernandez-Montes O, Barker DC, Monroy-Ostria A. Cutaneous leishmaniasis caused by members of Leishmania braziliensis complex in Nayarit, State of Mexico. Memorias do Instituto Oswaldo Cruz. 2001;96(1):15-9. Epub 2001/04/ Perez-Vega JH, Lopez-Moreno CY, Lopez-Valenzuela JA, Rendon-Maldonado JG, Lopez- Moreno HS. [Cutaneous leishmaniasis caused by Leishmania mexicana in Durango, Mexico: first clinical case report]. Gaceta medica de Mexico. 2009;145(5): Epub 2010/01/16. Leishmaniasis cutanea causada por Leishmania mexicana en Durango, Mexico. Informe del primer caso clinico. 31. Cordova-Uscanga C, Albertos-Alpuche NE, Andrade-Narvaez FJ, Canto-Lara SB. [Leishmaniasis: a preliminary epidemiological study in a locality of the endemic area in the state of the Tabasco]. Salud publica de Mexico. 1993;35(4): Epub 1993/07/01. Leishmaniasis: estudio epidemiologico preliminar en una localidad de la zona endemica del estado de Tabasco. 32. Salazar-Mejia PG, Tejeda-Aguirre CR, Lopez-Moreno HS. [Reaction of Leishmania (Leishmania) mexicana antigens by sera of patients with cutaneous leishmaniasis from Sinaloa, Mexico]. Salud publica de Mexico. 2010;52(2): Epub 2010/05/21. Reaccion de antigenos de Leishmania (Leishmania) mexicana con sueros de pacientes con leishmaniosis cutanea de Sinaloa, Mexico. 231

232 33. Ochoa-Diaz YO, Lopez-Moreno CY, Rendon-Maldonado JG, Lopez-Moreno HS. Molecular diagnosis of Leishmania mexicana in a cutaneous leishmaniasis case in Sinaloa, Mexico. Vector Borne Zoonotic Dis. 2012;12(1): Epub 2011/09/ Rodriguez N, Guzman B, Rodas A, Takiff H, Bloom BR, Convit J. Diagnosis of cutaneous leishmaniasis and species discrimination of parasites by PCR and hybridization. Journal of clinical microbiology. 1994;32(9): Epub 1994/09/ Kato H, Watanabe J, Mendoza Nieto I, Korenaga M, Hashiguchi Y. Leishmania species identification using FTA card sampling directly from patients' cutaneous lesions in the state of Lara, Venezuela. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2011;105(10): Epub 2011/09/ Calvopina M, Armijos RX, Marco JD, Uezato H, Kato H, Gomez EA, et al. Leishmania isoenzyme polymorphisms in Ecuador: relationships with geographic distribution and clinical presentation. BMC infectious diseases. 2006;6:139. Epub 2006/09/ Lucas CM, Franke ED, Cachay MI, Tejada A, Cruz ME, Kreutzer RD, et al. Geographic distribution and clinical description of leishmaniasis cases in Peru. The American journal of tropical medicine and hygiene. 1998;59(2): Epub 1998/08/ Bedoya-Pacheco SJ, Araujo-Melo MH, Valete-Rosalino CM, Pimentel MI, Conceicao-Silva F, Schubach AO, et al. Endemic tegumentary leishmaniasis in Brazil: correlation between level of endemicity and number of cases of mucosal disease. The American journal of tropical medicine and hygiene. 2011;84(6): Epub 2011/06/ Lima Junior MS, Andreotti R, Dorval ME, Oshiro ET, Oliveira AG, Matos Mde F. [Identification of Leishmania species isolated in human cases in Mato Grosso do Sul, by means of the polymerase chain reaction]. Revista da Sociedade Brasileira de Medicina Tropical. 2009;42(3): Epub 2009/08/18. Identificacao de especies de Leishmania isoladas de casos humanos em Mato Grosso do Sul por meio da reacao em cadeia da polimerase. 40. Brito ME, Andrade MS, Mendonca MG, Silva CJ, Almeida EL, Lima BS, et al. Species diversity of Leishmania (Viannia) parasites circulating in an endemic area for cutaneous leishmaniasis located in the Atlantic rainforest region of northeastern Brazil. Tropical medicine & international health : TM & IH. 2009;14(10): Epub 2009/08/ Tojal da Silva AC, Cupolillo E, Volpini AC, Almeida R, Romero GA. Species diversity causing human cutaneous leishmaniasis in Rio Branco, state of Acre, Brazil. Tropical medicine & international health : TM & IH. 2006;11(9): Epub 2006/08/ Camara Coelho LI, Paes M, Guerra JA, Barbosa M, Coelho C, Lima B, et al. Characterization of Leishmania spp. causing cutaneous leishmaniasis in Manaus, Amazonas, Brazil. Parasitology research. 2011;108(3): Epub 2010/11/ Passos VM, Fernandes O, Lacerda PA, Volpini AC, Gontijo CM, Degrave W, et al. Leishmania (Viannia) braziliensis is the predominant species infecting patients with American cutaneous leishmaniasis in the State of Minas Gerais, Southeast Brazil. Acta tropica. 1999;72(3): Epub 1999/05/ Garcia AL, Parrado R, Rojas E, Delgado R, Dujardin JC, Reithinger R. Leishmaniases in Bolivia: comprehensive review and current status. The American journal of tropical medicine and hygiene. 2009;80(5): Epub 2009/05/ Buitrago R, Cupolillo E, Bastrenta B, Le Pont F, Martinez E, Barnabe C, et al. PCR-RFLP of ribosomal internal transcribed spacers highlights inter and intra-species variation among Leishmania strains native to La Paz, Bolivia. Infection, genetics and evolution : journal of molecular 232

233 epidemiology and evolutionary genetics in infectious diseases. 2011;11(3): Epub 2010/12/ Tedesqui VL, Calleja GN, Parra R, Pabon JP, Boia MN, Carvalho-Costa FA. Active surveillance of American tegumentary leishmaniasis in endemic areas in rural Bolivia. Revista da Sociedade Brasileira de Medicina Tropical. 2012;45(1):30-4. Epub 2012/03/ Salomon OD, Quintana MG, Mastrangelo AV, Fernandez MS. Leishmaniasis and climate change-case study: Argentina. Journal of tropical medicine. 2012;2012: Epub 2012/06/ Peñuela MR, Sánchez JA. Una mirada a la epidemiología y al control de la leishmaniasis zoonótica en Colombia. Biosalud. 2007;6(Ene.-Dic): Rodriguez-Barraquer I, Gongora R, Prager M, Pacheco R, Montero LM, Navas A, et al. Etiologic agent of an epidemic of cutaneous leishmaniasis in Tolima, Colombia. The American journal of tropical medicine and hygiene. 2008;78(2): Epub 2008/02/ Rincon MY, Silva SY, Duenas RE, Lopez-Jaramillo P. [A report of two cases of disseminated cutaneous leishmaniasis in Santander, Colombia]. Rev Salud Publica (Bogota). 2009;11(1): Epub 2009/09/02. Leishmaniasis Cutanea Diseminada: Reporte de Dos Casos en Santander, Colombia. 51. Pinzon Redondo H, Orta López C, Juliao Cardona L, Agamez de Avila I, Motorel Bello E, Miranda Moncada Y, et al. Leishmaniasis visceral y cutanea en zona urbana de Cartagena, Colombia: reporte de un caso Colombia INdS. Boletin Epidemiologico semana 40. "Instituto Nacional de Salud Colombia", Pimenta PF, Saraiva EM, Rowton E, Modi GB, Garraway LA, Beverley SM, et al. Evidence that the vectorial competence of phlebotomine sand flies for different species of Leishmania is controlled by structural polymorphisms in the surface lipophosphoglycan. Proceedings of the National Academy of Sciences of the United States of America. 1994;91(19): Epub 1994/09/ Kamhawi S, Modi GB, Pimenta PF, Rowton E, Sacks DL. The vectorial competence of Phlebotomus sergenti is specific for Leishmania tropica and is controlled by species-specific, lipophosphoglycan-mediated midgut attachment. Parasitology. 2000;121 ( Pt 1): Epub 2000/11/ Killick-Kendrick R. The biology and control of phlebotomine sand flies. Clinics in dermatology. 1999;17(3): Epub 1999/06/ Killick-Kendrick R. Phlebotomine vectors of the leishmaniases: a review. Medical and veterinary entomology. 1990;4(1):1-24. Epub 1990/01/ Sacks DL. Leishmania-sand fly interactions controlling species-specific vector competence. Cellular microbiology. 2001;3(4): Epub 2001/04/ Sharma U, Singh S. Insect vectors of Leishmania: distribution, physiology and their control. Journal of vector borne diseases. 2008;45(4): Epub 2009/03/ Walters LL, Irons KP, Chaplin G, Tesh RB. Life cycle of Leishmania major (Kinetoplastida: Trypanosomatidae) in the neotropical sand fly Lutzomyia longipalpis (Diptera: Psychodidae). Journal of medical entomology. 1993;30(4): Epub 1993/07/ Sadlova J, Hajmova M, Volf P. Phlebotomus (Adlerius) halepensis vector competence for Leishmania major and Le. tropica. Medical and veterinary entomology. 2003;17(3): Epub 2003/08/

234 61. Rogers ME, Ilg T, Nikolaev AV, Ferguson MA, Bates PA. Transmission of cutaneous leishmaniasis by sand flies is enhanced by regurgitation of fppg. Nature. 2004;430(6998): Epub 2004/07/ Myskova J, Svobodova M, Beverley SM, Volf P. A lipophosphoglycan-independent development of Leishmania in permissive sand flies. Microbes and infection / Institut Pasteur. 2007;9(3): Epub 2007/02/ Volf P, Myskova J. Sand flies and Leishmania: specific versus permissive vectors. Trends in parasitology. 2007;23(3):91-2. Epub 2007/01/ Madeira MF, Schubach A, Schubach TM, Pacheco RS, Oliveira FS, Pereira SA, et al. Mixed infection with Leishmania (Viannia) braziliensis and Leishmania (Leishmania) chagasi in a naturally infected dog from Rio de Janeiro, Brazil. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2006;100(5): Epub 2005/11/ Gomes AH, Ferreira IM, Lima ML, Cunha EA, Garcia AS, Araujo MF, et al. PCR identification of Leishmania in diagnosis and control of canine Leishmaniasis. Veterinary parasitology. 2007;144(3-4): Epub 2007/01/ Brandao-Filho SP, Brito ME, Carvalho FG, Ishikawa EA, Cupolillo E, Floeter-Winter L, et al. Wild and synanthropic hosts of Leishmania (Viannia) braziliensis in the endemic cutaneous leishmaniasis locality of Amaraji, Pernambuco State, Brazil. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2003;97(3): Epub 2004/07/ Navarro JA, Sanchez J, Penafiel-Verdu C, Buendia AJ, Altimira J, Vilafranca M. Histopathological lesions in 15 cats with leishmaniosis. Journal of comparative pathology. 2010;143(4): Epub 2010/05/ Chaves LF, Hernandez MJ, Dobson AP, Pascual M. Sources and sinks: revisiting the criteria for identifying reservoirs for American cutaneous leishmaniasis. Trends in parasitology. 2007;23(7): Epub 2007/05/ Cupolillo E, Brahim LR, Toaldo CB, de Oliveira-Neto MP, de Brito ME, Falqueto A, et al. Genetic polymorphism and molecular epidemiology of Leishmania (Viannia) braziliensis from different hosts and geographic areas in Brazil. Journal of clinical microbiology. 2003;41(7): Epub 2003/07/ Riera C, Fisa R, Udina M, Gallego M, Portus M. Detection of Leishmania infantum cryptic infection in asymptomatic blood donors living in an endemic area (Eivissa, Balearic Islands, Spain) by different diagnostic methods. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2004;98(2): Epub 2004/02/ Michel G, Pomares C, Ferrua B, Marty P. Importance of worldwide asymptomatic carriers of Leishmania infantum (L. chagasi) in human. Acta tropica. 2011;119(2-3): Epub 2011/06/ le Fichoux Y, Quaranta JF, Aufeuvre JP, Lelievre A, Marty P, Suffia I, et al. Occurrence of Leishmania infantum parasitemia in asymptomatic blood donors living in an area of endemicity in southern France. Journal of clinical microbiology. 1999;37(6): Epub 1999/05/ Sharma MC, Gupta AK, Das VN, Verma N, Kumar N, Saran R, et al. Leishmania donovani in blood smears of asymptomatic persons. Acta tropica. 2000;76(2): Epub 2000/08/ Fagundes A, Marzochi MC, Fernandes O, Perez MA, Schubach AO, Schubach TM, et al. First encounter of subclinical human Leishmania (Viannia) infection in State of Rio Grande do Sul, Brazil. Memorias do Instituto Oswaldo Cruz. 2007;102(8): Epub 2008/01/ Follador I, Araujo C, Bacellar O, Araujo CB, Carvalho LP, Almeida RP, et al. Epidemiologic and immunologic findings for the subclinical form of Leishmania braziliensis infection. Clinical 234

235 infectious diseases : an official publication of the Infectious Diseases Society of America. 2002;34(11):E54-8. Epub 2002/05/ Goto H, Lauletta Lindoso JA. Cutaneous and mucocutaneous leishmaniasis. Infectious disease clinics of North America. 2012;26(2): Epub 2012/05/ Machado P, Araujo C, Da Silva AT, Almeida RP, D'Oliveira Jr A, Bittencourt A, et al. Failure of early treatment of cutaneous leishmaniasis in preventing the development of an ulcer. Clinical infectious diseases : an official publication of the Infectious Diseases Society of America. 2002;34(12):E Epub 2002/05/ Vendrame CM, Souza LD, Carvalho MD, Salgado K, Carvalho EM, Goto H. Insulin-like growth factor-i induced and constitutive arginase activity differs among isolates of Leishmania derived from patients with diverse clinical forms of Leishmania braziliensis infection. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2010;104(8): Epub 2010/05/ Schriefer A, Wilson ME, Carvalho EM. Recent developments leading toward a paradigm switch in the diagnostic and therapeutic approach to human leishmaniasis. Current opinion in infectious diseases. 2008;21(5): Epub 2008/08/ Bittencourt AL, Costa JM, Carvalho EM, Barral A. Leishmaniasis recidiva cutis in American cutaneous leishmaniasis. International journal of dermatology. 1993;32(11): Epub 1993/11/ Calvopina M, Uezato H, Gomez EA, Korenaga M, Nonaka S, Hashiguchi Y. Leishmaniasis recidiva cutis due to Leishmania (Viannia) panamensis in subtropical Ecuador: isoenzymatic characterization. International journal of dermatology. 2006;45(2): Epub 2006/02/ Turetz ML, Machado PR, Ko AI, Alves F, Bittencourt A, Almeida RP, et al. Disseminated leishmaniasis: a new and emerging form of leishmaniasis observed in northeastern Brazil. The Journal of infectious diseases. 2002;186(12): Epub 2002/11/ Vieira-Goncalves R, Pirmez C, Jorge ME, Souza WJ, Oliveira MP, Rutowitsch MS, et al. Clinical features of cutaneous and disseminated cutaneous leishmaniasis caused by Leishmania (Viannia) braziliensis in Paraty, Rio de Janeiro. International journal of dermatology. 2008;47(9): Epub 2008/10/ the WECo, Leishmaniases Co. Control of the leishmaniases. Geneva: WHO; 2010 [22 26 March 2010]; 949:[Report of a meeting of the WHO Expert Committee on the Control of Leishmaniases]. Available from: Barral A, Costa JM, Bittencourt AL, Barral-Netto M, Carvalho EM. Polar and subpolar diffuse cutaneous leishmaniasis in Brazil: clinical and immunopathologic aspects. International journal of dermatology. 1995;34(7): Epub 1995/07/ Lessa MM, Lessa HA, Castro TW, Oliveira A, Scherifer A, Machado P, et al. Mucosal leishmaniasis: epidemiological and clinical aspects. Brazilian journal of otorhinolaryngology. 2007;73(6): Epub 2008/02/ Faucher B, Pomares C, Fourcade S, Benyamine A, Marty P, Pratlong L, et al. Mucosal Leishmania infantum leishmaniasis: specific pattern in a multicentre survey and historical cases. The Journal of infection. 2011;63(1): Epub 2011/06/ Davies CR, Reithinger R, Campbell-Lendrum D, Feliciangeli D, Borges R, Rodriguez N. The epidemiology and control of leishmaniasis in Andean countries. Cadernos de saude publica. 2000;16(4): Epub 2001/02/ Zijlstra EE, Musa AM, Khalil EA, el-hassan IM, el-hassan AM. Post-kala-azar dermal leishmaniasis. The Lancet infectious diseases. 2003;3(2): Epub 2003/02/

236 90. Tsukayama P, Nunez JH, De Los Santos M, Soberon V, Lucas CM, Matlashewski G, et al. A FRET-based real-time PCR assay to identify the main causal agents of New World tegumentary leishmaniasis. PLoS neglected tropical diseases. 2013;7(1):e1956. Epub 2013/01/ Arevalo J, Ramirez L, Adaui V, Zimic M, Tulliano G, Miranda-Verastegui C, et al. Influence of Leishmania (Viannia) species on the response to antimonial treatment in patients with American tegumentary leishmaniasis. The Journal of infectious diseases. 2007;195(12): Epub 2007/05/ Ameen M. Cutaneous leishmaniasis: therapeutic strategies and future directions. Expert opinion on pharmacotherapy. 2007;8(16): Epub 2007/10/ Escobar MA, Martinez F, Scott Smith D, Palma GI. American cutaneous and mucocutaneous leishmaniasis (tegumentary): a diagnostic challenge. Tropical doctor. 1992;22 Suppl 1:69-78;63-4. Epub 1992/01/ Pirmez C, da Silva Trajano V, Paes-Oliveira Neto M, da-cruz AM, Goncalves-da-Costa SC, Catanho M, et al. Use of PCR in diagnosis of human american tegumentary leishmaniasis in Rio de Janeiro, Brazil. Journal of clinical microbiology. 1999;37(6): Epub 1999/05/ Rodrigues EH, Felinto de Brito ME, Mendonca MG, Werkhauser RP, Coutinho EM, Souza WV, et al. Evaluation of PCR for diagnosis of American cutaneous leishmaniasis in an area of endemicity in northeastern Brazil. Journal of clinical microbiology. 2002;40(10): Epub 2002/10/ de Oliveira CI, Bafica A, Oliveira F, Favali CB, Correa T, Freitas LA, et al. Clinical utility of polymerase chain reaction-based detection of Leishmania in the diagnosis of American cutaneous leishmaniasis. Clinical infectious diseases : an official publication of the Infectious Diseases Society of America. 2003;37(11):e Epub 2003/11/ Gomes AH, Armelin IM, Menon SZ, Pereira-Chioccola VL. Leishmania (V.) braziliensis: detection by PCR in biopsies from patients with cutaneous leishmaniasis. Experimental parasitology. 2008;119(3): Epub 2008/04/ Volpini AC, Passos VM, Oliveira GC, Romanha AJ. PCR-RFLP to identify Leishmania (Viannia) braziliensis and L. (Leishmania) amazonensis causing American cutaneous leishmaniasis. Acta tropica. 2004;90(1):31-7. Epub 2004/01/ Santos DO, Coutinho CE, Madeira MF, Bottino CG, Vieira RT, Nascimento SB, et al. Leishmaniasis treatment--a challenge that remains: a review. Parasitology research. 2008;103(1):1-10. Epub 2008/04/ Mondal S, Bhattacharya P, Ali N. Current diagnosis and treatment of visceral leishmaniasis. Expert review of anti-infective therapy. 2010;8(8): Epub 2010/08/ Murray HW. Treatment of visceral leishmaniasis in 2010: direction from Bihar State, India. Future microbiology. 2010;5(9): Epub 2010/09/ Vanlerberghe V, Diap G, Guerin PJ, Meheus F, Gerstl S, Van der Stuyft P, et al. Drug policy for visceral leishmaniasis: a cost-effectiveness analysis. Tropical medicine & international health : TM & IH. 2007;12(2): Epub 2007/02/ Goodwin LG. Pentostam (sodium stibogluconate); a 50-year personal reminiscence. Transactions of the Royal Society of Tropical Medicine and Hygiene. 1995;89(3): Epub 1995/05/ Berman JD. Human leishmaniasis: clinical, diagnostic, and chemotherapeutic developments in the last 10 years. Clinical infectious diseases : an official publication of the Infectious Diseases Society of America. 1997;24(4): Epub 1997/04/

237 105. Olliaro PL, Bryceson AD. Practical progress and new drugs for changing patterns of leishmaniasis. Parasitol Today. 1993;9(9): Epub 1993/01/ Veeken H, Ritmeijer K, Seaman J, Davidson R. A randomized comparison of branded sodium stibogluconate and generic sodium stibogluconate for the treatment of visceral leishmaniasis under field conditions in Sudan. Tropical medicine & international health : TM & IH. 2000;5(5): Epub 2000/07/ Llanos-Cuentas A, Tulliano G, Araujo-Castillo R, Miranda-Verastegui C, Santamaria- Castrellon G, Ramirez L, et al. Clinical and parasite species risk factors for pentavalent antimonial treatment failure in cutaneous leishmaniasis in Peru. Clinical infectious diseases : an official publication of the Infectious Diseases Society of America. 2008;46(2): Epub 2008/01/ Ait-Oudhia K, Gazanion E, Vergnes B, Oury B, Sereno D. Leishmania antimony resistance: what we know what we can learn from the field. Parasitology research. 2011;109(5): Epub 2011/07/ Furtado TA. Clinical results in the treatment of American leishmaniasis with oral and intravenous amphotericin. Antibiotics annual. 1959;7: Epub 1959/01/ Sampaio SA, Godoy JT, Paiva L, Dillon NL, da LC. The treatment of American (mucocutaneous) leishmaniasis with amphotericin B. Archives of dermatology. 1960;82: Epub 1960/10/ Sampaio SA, Castro RM, Dillon NL, Martins JE. Treatment of mucocutaneous (American) leishmaniasis with amphotericin B: report of 70 cases. International journal of dermatology. 1971;10(3): Epub 1971/07/ Khoo SH, Bond J, Denning DW. Administering amphotericin B--a practical approach. The Journal of antimicrobial chemotherapy. 1994;33(2): Epub 1994/02/ Nonata R, Sampaio R, Marsden PD. Mucosal leishmaniasis unresponsive to glucantime therapy successfully treated with AmBisome. Transactions of the Royal Society of Tropical Medicine and Hygiene. 1997;91(1):77. Epub 1997/01/ Thakur CP, Kumar M, Pandey AK. Comparison of regimes of treatment of antimonyresistant kala-azar patients: a randomized study. The American journal of tropical medicine and hygiene. 1991;45(4): Epub 1991/10/ Soto J, Buffet P, Grogl M, Berman J. Successful treatment of Colombian cutaneous leishmaniasis with four injections of pentamidine. The American journal of tropical medicine and hygiene. 1994;50(1): Epub 1994/01/ Jha TK. Evaluation of diamidine compound (pentamidine isethionate) in the treatment resistant cases of kala-azar occurring in North Bihar, India. Transactions of the Royal Society of Tropical Medicine and Hygiene. 1983;77(2): Epub 1983/01/ Croft SL, Neal RA, Pendergast W, Chan JH. The activity of alkyl phosphorylcholines and related derivatives against Leishmania donovani. Biochemical pharmacology. 1987;36(16): Epub 1987/08/ Kuhlencord A, Maniera T, Eibl H, Unger C. Hexadecylphosphocholine: oral treatment of visceral leishmaniasis in mice. Antimicrobial agents and chemotherapy. 1992;36(8): Epub 1992/08/ Le Fichoux Y, Rousseau D, Ferrua B, Ruette S, Lelievre A, Grousson D, et al. Short- and longterm efficacy of hexadecylphosphocholine against established Leishmania infantum infection in BALB/c mice. Antimicrobial agents and chemotherapy. 1998;42(3): Epub 1998/03/ Herwaldt BL. Miltefosine--the long-awaited therapy for visceral leishmaniasis? The New England journal of medicine. 1999;341(24): Epub 1999/12/

238 121. Sundar S, Rosenkaimer F, Makharia MK, Goyal AK, Mandal AK, Voss A, et al. Trial of oral miltefosine for visceral leishmaniasis. Lancet. 1998;352(9143): Epub 1998/12/ Jha TK, Sundar S, Thakur CP, Bachmann P, Karbwang J, Fischer C, et al. Miltefosine, an oral agent, for the treatment of Indian visceral leishmaniasis. The New England journal of medicine. 1999;341(24): Epub 1999/12/ Soto J, Rea J, Valderrama M, Toledo J, Valda L, Ardiles J, et al. Efficacy of extended (six weeks) treatment with miltefosine for mucosal leishmaniasis in Bolivia. The American journal of tropical medicine and hygiene. 2009;81(3): Epub 2009/08/ Sundar S, Gupta LB, Makharia MK, Singh MK, Voss A, Rosenkaimer F, et al. Oral treatment of visceral leishmaniasis with miltefosine. Annals of tropical medicine and parasitology. 1999;93(6): Epub 2000/03/ Escobar P, Yardley V, Croft SL. Activities of hexadecylphosphocholine (miltefosine), AmBisome, and sodium stibogluconate (Pentostam) against Leishmania donovani in immunodeficient scid mice. Antimicrobial agents and chemotherapy. 2001;45(6): Epub 2001/05/ Berman JJ. Treatment of leishmaniasis with miltefosine: 2008 status. Expert opinion on drug metabolism & toxicology. 2008;4(9): Epub 2008/08/ Teklemariam S, Hiwot AG, Frommel D, Miko TL, Ganlov G, Bryceson A. Aminosidine and its combination with sodium stibogluconate in the treatment of diffuse cutaneous leishmaniasis caused by Leishmania aethiopica. Transactions of the Royal Society of Tropical Medicine and Hygiene. 1994;88(3): Epub 1994/05/ Thakur CP, Bhowmick S, Dolfi L, Olliaro P. Aminosidine plus sodium stibogluconate for the treatment of Indian kala-azar: a randomized dose-finding clinical trial. Transactions of the Royal Society of Tropical Medicine and Hygiene. 1995;89(2): Epub 1995/03/ Thakur CP, Kanyok TP, Pandey AK, Sinha GP, Zaniewski AE, Houlihan HH, et al. A prospective randomized, comparative, open-label trial of the safety and efficacy of paromomycin (aminosidine) plus sodium stibogluconate versus sodium stibogluconate alone for the treatment of visceral leishmaniasis. Transactions of the Royal Society of Tropical Medicine and Hygiene. 2000;94(4): Epub 2000/12/ Berman JD, Goad LJ, Beach DH, Holz GG, Jr. Effects of ketoconazole on sterol biosynthesis by Leishmania mexicana mexicana amastigotes in murine macrophage tumor cells. Molecular and biochemical parasitology. 1986;20(1): Epub 1986/07/ Hart DT, Lauwers WJ, Willemsens G, Vanden Bossche H, Opperdoes FR. Perturbation of sterol biosynthesis by itraconazole and ketoconazole in Leishmania mexicana mexicana infected macrophages. Molecular and biochemical parasitology. 1989;33(2): Epub 1989/03/ Wyllie S, Patterson S, Stojanovski L, Simeons FR, Norval S, Kime R, et al. The antitrypanosome drug fexinidazole shows potential for treating visceral leishmaniasis. Science translational medicine. 2012;4(119):119re1. Epub 2012/02/ Rioux JA, Lanotte G, Serres E, Pratlong F, Bastien P, Perieres J. Taxonomy of Leishmania. Use of isoenzymes. Suggestions for a new classification. Annales de parasitologie humaine et comparee. 1990;65(3): Epub 1990/01/ Shaw JJ. Taxonomy of the genus Leishmania: present and future trends and their implications. Memorias do Instituto Oswaldo Cruz. 1994;89(3): Epub 1994/07/ Adl SM, Simpson AG, Farmer MA, Andersen RA, Anderson OR, Barta JR, et al. The new higher level classification of eukaryotes with emphasis on the taxonomy of protists. The Journal of eukaryotic microbiology. 2005;52(5): Epub 2005/10/

239 136. Logan-Klumpler FJ, De Silva N, Boehme U, Rogers MB, Velarde G, McQuillan JA, et al. GeneDB--an annotation database for pathogens. Nucleic acids research. 2012;40(Database issue):d Epub 2011/11/ Ivens AC, Peacock CS, Worthey EA, Murphy L, Aggarwal G, Berriman M, et al. The genome of the kinetoplastid parasite, Leishmania major. Science. 2005;309(5733): Epub 2005/07/ Wincker P, Ravel C, Blaineau C, Pages M, Jauffret Y, Dedet JP, et al. The Leishmania genome comprises 36 chromosomes conserved across widely divergent human pathogenic species. Nucleic acids research. 1996;24(9): Epub 1996/05/ Lighthall GK, Giannini SH. The chromosomes of Leishmania. Parasitol Today. 1992;8(6): Epub 1992/06/ Blaineau C, Bastien P, Rioux JA, Roizes G, Pages M. Long-range restriction maps of sizevariable homologous chromosomes in Leishmania infantum. Molecular and biochemical parasitology. 1991;46(2): Epub 1991/06/ Requena JM, Soto M, Quijada L, Alonso C. Genes and chromosomes of Leishmania infantum. Memorias do Instituto Oswaldo Cruz. 1997;92(6): Epub 1998/05/ Sunkin SM, Kiser P, Myler PJ, Stuart K. The size difference between leishmania major friedlin chromosome one homologues is localized to sub-telomeric repeats at one chromosomal end. Molecular and biochemical parasitology. 2000;109(1):1-15. Epub 2000/08/ Peacock CS, Seeger K, Harris D, Murphy L, Ruiz JC, Quail MA, et al. Comparative genomic analysis of three Leishmania species that cause diverse human disease. Nature genetics. 2007;39(7): Epub 2007/06/ Bard E. Molecular biology of Leishmania. Biochemistry and cell biology = Biochimie et biologie cellulaire. 1989;67(9): Epub 1989/09/ Britto C, Ravel C, Bastien P, Blaineau C, Pages M, Dedet JP, et al. Conserved linkage groups associated with large-scale chromosomal rearrangements between Old World and New World Leishmania genomes. Gene. 1998;222(1): Epub 1998/11/ Rogers MB, Hilley JD, Dickens NJ, Wilkes J, Bates PA, Depledge DP, et al. Chromosome and gene copy number variation allow major structural change between species and strains of Leishmania. Genome research. 2011;21(12): Epub 2011/11/ Bringaud F, Ghedin E, Blandin G, Bartholomeu DC, Caler E, Levin MJ, et al. Evolution of non-ltr retrotransposons in the trypanosomatid genomes: Leishmania major has lost the active elements. Molecular and biochemical parasitology. 2006;145(2): Epub 2005/11/ Aksoy S, Williams S, Chang S, Richards FF. SLACS retrotransposon from Trypanosoma brucei gambiense is similar to mammalian LINEs. Nucleic acids research. 1990;18(4): Epub 1990/02/ Villanueva MS, Williams SP, Beard CB, Richards FF, Aksoy S. A new member of a family of site-specific retrotransposons is present in the spliced leader RNA genes of Trypanosoma cruzi. Molecular and cellular biology. 1991;11(12): Epub 1991/12/ Smith DF, Peacock CS, Cruz AK. Comparative genomics: from genotype to disease phenotype in the leishmaniases. International journal for parasitology. 2007;37(11): Epub 2007/07/ Smith M, Bringaud F, Papadopoulou B. Organization and evolution of two SIDER retroposon subfamilies and their impact on the Leishmania genome. BMC genomics. 2009;10:240. Epub 2009/05/

240 152. Requena JM, Folgueira C, Lopez MC, Thomas MC. The SIDER2 elements, interspersed repeated sequences that populate the Leishmania genomes, constitute subfamilies showing chromosomal proximity relationship. BMC genomics. 2008;9:263. Epub 2008/06/ Ullu E, Kolev N, Barnes R, Tschudi C. The RNA Interference Pathway in Trypanosoma brucei. In: Bindereif A, editor. RNA Metabolism in Trypanosomes: Springer Berlin Heidelberg; p Lye LF, Owens K, Shi H, Murta SM, Vieira AC, Turco SJ, et al. Retention and loss of RNA interference pathways in trypanosomatid protozoans. PLoS pathogens. 2010;6(10):e Epub 2010/11/ Kolev NG, Tschudi C, Ullu E. RNA interference in protozoan parasites: achievements and challenges. Eukaryotic cell. 2011;10(9): Epub 2011/07/ McNicoll F, Drummelsmith J, Muller M, Madore E, Boilard N, Ouellette M, et al. A combined proteomic and transcriptomic approach to the study of stage differentiation in Leishmania infantum. Proteomics. 2006;6(12): Epub 2006/05/ Papadopoulou B, Huang XF, Boucher N, McNicoll F. Stage-specific regulation of gene expression in Leishmania. ASM News. 2003;69: Martinez-Calvillo S, Yan S, Nguyen D, Fox M, Stuart K, Myler PJ. Transcription of Leishmania major Friedlin chromosome 1 initiates in both directions within a single region. Molecular cell. 2003;11(5): Epub 2003/05/ Cohen-Freue G, Holzer TR, Forney JD, McMaster WR. Global gene expression in Leishmania. International journal for parasitology. 2007;37(10): Epub 2007/06/ Saito RM, Elgort MG, Campbell DA. A conserved upstream element is essential for transcription of the Leishmania tarentolae mini-exon gene. The EMBO journal. 1994;13(22): Epub 1994/11/ Kapler GM, Beverley SM. Transcriptional mapping of the amplified region encoding the dihydrofolate reductase-thymidylate synthase of Leishmania major reveals a high density of transcripts, including overlapping and antisense RNAs. Molecular and cellular biology. 1989;9(9): Epub 1989/09/ Campbell DA, Thomas S, Sturm NR. Transcription in kinetoplastid protozoa: why be normal? Microbes and infection / Institut Pasteur. 2003;5(13): Epub 2003/11/ Mandelboim M, Estrano CL, Tschudi C, Ullu E, Michaeli S. On the role of exon and intron sequences in trans-splicing utilization and cap 4 modification of the trypanosomatid Leptomonas collosoma SL RNA. The Journal of biological chemistry. 2002;277(38): Epub 2002/07/ Zinoviev A, Shapira M. Evolutionary conservation and diversification of the translation initiation apparatus in trypanosomatids. Comparative and functional genomics. 2012;2012: Epub 2012/07/ Matthews KR, Tschudi C, Ullu E. A common pyrimidine-rich motif governs trans-splicing and polyadenylation of tubulin polycistronic pre-mrna in trypanosomes. Genes & development. 1994;8(4): Epub 1994/02/ Ullu E, Matthews KR, Tschudi C. Temporal order of RNA-processing reactions in trypanosomes: rapid trans splicing precedes polyadenylation of newly synthesized tubulin transcripts. Molecular and cellular biology. 1993;13(1): Epub 1993/01/ Donelson JE, Gardner MJ, El-Sayed NM. More surprises from Kinetoplastida. Proceedings of the National Academy of Sciences of the United States of America. 1999;96(6): Epub 1999/03/

241 168. Stiles JK, Hicock PI, Shah PH, Meade JC. Genomic organization, transcription, splicing and gene regulation in Leishmania. Annals of tropical medicine and parasitology. 1999;93(8): Epub 2000/03/ Papadopoulou B, Huang XF, Boucher N, F M. Stagespecific regulation of gene expression in Leishmania. ASM News. 2003;69: Charest H, Zhang WW, Matlashewski G. The developmental expression of Leishmania donovani A2 amastigote-specific genes is post-transcriptionally mediated and involves elements located in the 3'-untranslated region. The Journal of biological chemistry. 1996;271(29): Epub 1996/07/ Mishra KK, Holzer TR, Moore LL, LeBowitz JH. A negative regulatory element controls mrna abundance of the Leishmania mexicana Paraflagellar rod gene PFR2. Eukaryotic cell. 2003;2(5): Epub 2003/10/ Larreta R, Soto M, Quijada L, Folgueira C, Abanades DR, Alonso C, et al. The expression of HSP83 genes in Leishmania infantum is affected by temperature and by stage-differentiation and is regulated at the levels of mrna stability and translation. BMC molecular biology. 2004;5:3. Epub 2004/06/ Purdy JE, Donelson JE, Wilson ME. Leishmania chagasi: the alpha-tubulin intercoding region results in constant levels of mrna abundance despite protein synthesis inhibition and growth state. Experimental parasitology. 2005;110(2): Epub 2005/05/ Zick A, Onn I, Bezalel R, Margalit H, Shlomai J. Assigning functions to genes: identification of S-phase expressed genes in Leishmania major based on post-transcriptional control elements. Nucleic acids research. 2005;33(13): Epub 2005/07/ Quijada L, Soto M, Alonso C, Requena JM. Identification of a putative regulatory element in the 3'-untranslated region that controls expression of HSP70 in Leishmania infantum. Molecular and biochemical parasitology. 2000;110(1): Epub 2000/09/ Holzer TR, Mishra KK, LeBowitz JH, Forney JD. Coordinate regulation of a family of promastigote-enriched mrnas by the 3'UTR PRE element in Leishmania mexicana. Molecular and biochemical parasitology. 2008;157(1): Epub 2007/11/ Tschudi C, Ullu E. Destruction of U2, U4, or U6 small nuclear RNA blocks trans splicing in trypanosome cells. Cell. 1990;61(3): Epub 1990/05/ Brooks DR, Denise H, Westrop GD, Coombs GH, Mottram JC. The stage-regulated expression of Leishmania mexicana CPB cysteine proteases is mediated by an intercistronic sequence element. The Journal of biological chemistry. 2001;276(50): Epub 2001/10/ Fluck C, Salomone JY, Kurath U, Roditi I. Cycloheximide-mediated accumulation of transcripts from a procyclin expression site depends on the intergenic region. Molecular and biochemical parasitology. 2003;127(1):93-7. Epub 2003/03/ Milone J, Wilusz J, Bellofatto V. Identification of mrna decapping activities and an AREregulated 3' to 5' exonuclease activity in trypanosome extracts. Nucleic acids research. 2002;30(18): Epub 2002/09/ Haile S, Estevez AM, Clayton C. A role for the exosome in the in vivo degradation of unstable mrnas. RNA. 2003;9(12): Epub 2003/11/ Li CH, Irmer H, Gudjonsdottir-Planck D, Freese S, Salm H, Haile S, et al. Roles of a Trypanosoma brucei 5'->3' exoribonuclease homolog in mrna degradation. RNA. 2006;12(12): Epub 2006/11/

242 183. Murray AS, Lynn MA, McMaster WR. The Leishmania mexicana A600 genes are functionally required for amastigote replication. Molecular and biochemical parasitology. 2010;172(2):80-9. Epub 2010/03/ Murray A, Fu C, Habibi G, McMaster WR. Regions in the 3' untranslated region confer stage-specific expression to the Leishmania mexicana a600-4 gene. Molecular and biochemical parasitology. 2007;153(2): Epub 2007/04/ Aly R, Argaman M, Halman S, Shapira M. A regulatory role for the 5' and 3' untranslated regions in differential expression of hsp83 in Leishmania. Nucleic acids research. 1994;22(15): Epub 1994/08/ Argaman M, Aly R, Shapira M. Expression of heat shock protein 83 in Leishmania is regulated post-transcriptionally. Molecular and biochemical parasitology. 1994;64(1): Epub 1994/03/ Purdy JE, Donelson JE, Wilson ME. Regulation of genes encoding the major surface protease of Leishmania chagasi via mrna stability. Molecular and biochemical parasitology. 2005;142(1): Epub 2005/05/ Narberhaus F, Waldminghaus T, Chowdhury S. RNA thermometers. FEMS microbiology reviews. 2006;30(1):3-16. Epub 2006/01/ Richter JD, Sonenberg N. Regulation of cap-dependent translation by eif4e inhibitory proteins. Nature. 2005;433(7025): Epub 2005/02/ Zilka A, Garlapati S, Dahan E, Yaolsky V, Shapira M. Developmental regulation of heat shock protein 83 in Leishmania. 3' processing and mrna stability control transcript abundance, and translation id directed by a determinant in the 3'-untranslated region. The Journal of biological chemistry. 2001;276(51): Epub 2001/10/ Myung KS, Beetham JK, Wilson ME, Donelson JE. Comparison of the post-transcriptional regulation of the mrnas for the surface proteins PSA (GP46) and MSP (GP63) of Leishmania chagasi. The Journal of biological chemistry. 2002;277(19): Epub 2002/02/ Lee MG. The 3' untranslated region of the hsp 70 genes maintains the level of steady state mrna in Trypanosoma brucei upon heat shock. Nucleic acids research. 1998;26(17): Epub 1998/08/ Wu Y, El Fakhry Y, Sereno D, Tamar S, Papadopoulou B. A new developmentally regulated gene family in Leishmania amastigotes encoding a homolog of amastin surface proteins. Molecular and biochemical parasitology. 2000;110(2): Epub 2000/11/ Boucher N, Wu Y, Dumas C, Dube M, Sereno D, Breton M, et al. A common mechanism of stage-regulated gene expression in Leishmania mediated by a conserved 3'-untranslated region element. The Journal of biological chemistry. 2002;277(22): Epub 2002/03/ McNicoll F, Muller M, Cloutier S, Boilard N, Rochette A, Dube M, et al. Distinct 3'- untranslated region elements regulate stage-specific mrna accumulation and translation in Leishmania. The Journal of biological chemistry. 2005;280(42): Epub 2005/08/ David M, Gabdank I, Ben-David M, Zilka A, Orr I, Barash D, et al. Preferential translation of Hsp83 in Leishmania requires a thermosensitive polypyrimidine-rich element in the 3' UTR and involves scanning of the 5' UTR. RNA. 2010;16(2): Epub 2009/12/ Maslov DA, Kolesnikov AA, Zaitseva GN. Conservative and divergent base sequence regions in the maxicircle kinetoplast DNA of several trypanosomatid flagellates. Molecular and biochemical parasitology. 1984;12(3): Epub 1984/07/

243 198. Muhich ML, Neckelmann N, Simpson L. The divergent region of the Leishmania tarentolae kinetoplast maxicircle DNA contains a diverse set of repetitive sequences. Nucleic acids research. 1985;13(9): Epub 1985/05/ Flegontov PN, Guo Q, Ren L, Strelkova MV, Kolesnikov AA. Conserved repeats in the kinetoplast maxicircle divergent region of Leishmania sp. and Leptomonas seymouri. Molecular genetics and genomics : MGG. 2006;276(4): Epub 2006/08/ Lukes J, Guilbride DL, Votypka J, Zikova A, Benne R, Englund PT. Kinetoplast DNA network: evolution of an improbable structure. Eukaryotic cell. 2002;1(4): Epub 2002/11/ Simpson L. Kinetoplast DNA in trypanosomid flagellates. International review of cytology. 1986;99: Epub 1986/01/ Bhat GJ, Koslowsky DJ, Feagin JE, Smiley BL, Stuart K. An extensively edited mitochondrial transcript in kinetoplastids encodes a protein homologous to ATPase subunit 6. Cell. 1990;61(5): Epub 1990/06/ Shaw JM, Feagin JE, Stuart K, Simpson L. Editing of kinetoplastid mitochondrial mrnas by uridine addition and deletion generates conserved amino acid sequences and AUG initiation codons. Cell. 1988;53(3): Epub 1988/05/ Simpson L, Sbicego S, Aphasizhev R. Uridine insertion/deletion RNA editing in trypanosome mitochondria: a complex business. RNA. 2003;9(3): Epub 2003/02/ Estevez AM, Simpson L. Uridine insertion/deletion RNA editing in trypanosome mitochondria--a review. Gene. 1999;240(2): Epub 1999/12/ Stuart KD, Schnaufer A, Ernst NL, Panigrahi AK. Complex management: RNA editing in trypanosomes. Trends in biochemical sciences. 2005;30(2): Epub 2005/02/ Cifuentes-Rojas C, Halbig K, Sacharidou A, De Nova-Ocampo M, Cruz-Reyes J. Minimal premrna substrates with natural and converted sites for full-round U insertion and U deletion RNA editing in trypanosomes. Nucleic acids research. 2005;33(20): Epub 2005/11/ Cruz-Reyes J, Sollner-Webb B. Trypanosome U-deletional RNA editing involves guide RNAdirected endonuclease cleavage, terminal U exonuclease, and RNA ligase activities. Proceedings of the National Academy of Sciences of the United States of America. 1996;93(17): Epub 1996/08/ Lukes J, Hashimi H, Zikova A. Unexplained complexity of the mitochondrial genome and transcriptome in kinetoplastid flagellates. Current genetics. 2005;48(5): Epub 2005/10/ Eperon IC, Janssen JW, Hoeijmakers JH, Borst P. The major transcripts of the kinetoplast DNA of Trypanosoma brucei are very small ribosomal RNAs. Nucleic acids research. 1983;11(1): Epub 1983/01/ Benne R, De Vries BF, Van den Burg J, Klaver B. The nucleotide sequence of a segment of Trypanosoma brucei mitochondrial maxi-circle DNA that contains the gene for apocytochrome b and some unusual unassigned reading frames. Nucleic acids research. 1983;11(20): Epub 1983/10/ Sloof P, Van den Burg J, Voogd A, Benne R, Agostinelli M, Borst P, et al. Further characterization of the extremely small mitochondrial ribosomal RNAs from trypanosomes: a detailed comparison of the 9S and 12S RNAs from Crithidia fasciculata and Trypanosoma brucei with rrnas from other organisms. Nucleic acids research. 1985;13(11): Epub 1985/06/ Westenberger SJ, Cerqueira GC, El-Sayed NM, Zingales B, Campbell DA, Sturm NR. Trypanosoma cruzi mitochondrial maxicircles display species- and strain-specific variation and a conserved element in the non-coding region. BMC genomics. 2006;7:60. Epub 2006/03/

244 214. Sloof P, van den Burg J, Voogd A, Benne R. The nucleotide sequence of a 3.2 kb segment of mitochondrial maxicircle DNA from Crithidia fasciculata containing the gene for cytochrome oxidase subunit III, the N-terminal part of the apocytochrome b gene and a possible frameshift gene; further evidence for the use of unusual initiator triplets in trypanosome mitochondria. Nucleic acids research. 1987;15(1): Epub 1987/01/ van der Spek H, Arts GJ, Zwaal RR, van den Burg J, Sloof P, Benne R. Conserved genes encode guide RNAs in mitochondria of Crithidia fasciculata. The EMBO journal. 1991;10(5): Epub 1991/05/ Maslov DA, Hollar L, Haghighat P, Nawathean P. Demonstration of mrna editing and localization of guide RNA genes in kinetoplast-mitochondria of the plant trypanosomatid Phytomonas serpens. Molecular and biochemical parasitology. 1998;93(2): Epub 1998/07/ Maslov DA, Nawathean P, Scheel J. Partial kinetoplast-mitochondrial gene organization and expression in the respiratory deficient plant trypanosomatid Phytomonas serpens. Molecular and biochemical parasitology. 1999;99(2): Epub 1999/05/ Shapira M, McEwen JG, Jaffe CL. Temperature effects on molecular processes which lead to stage differentiation in Leishmania. The EMBO journal. 1988;7(9): Epub 1988/09/ Maresca B, Kobayashi GS. Hsp70 in parasites: as an inducible protective protein and as an antigen. Experientia. 1994;50(11-12): Epub 1994/11/ Young JC, Barral JM, Ulrich Hartl F. More than folding: localized functions of cytosolic chaperones. Trends in biochemical sciences. 2003;28(10): Epub 2003/10/ Pratt WB, Toft DO. Regulation of signaling protein function and trafficking by the hsp90/hsp70-based chaperone machinery. Exp Biol Med (Maywood). 2003;228(2): Epub 2003/02/ Neupert W, Brunner M. The protein import motor of mitochondria. Nature reviews Molecular cell biology. 2002;3(8): Epub 2002/08/ Hartl FU, Hayer-Hartl M. Molecular chaperones in the cytosol: from nascent chain to folded protein. Science. 2002;295(5561): Epub 2002/03/ Ryan MT, Pfanner N. Hsp70 proteins in protein translocation. Advances in protein chemistry. 2001;59: Epub 2002/03/ Bukau B, Deuerling E, Pfund C, Craig EA. Getting newly synthesized proteins into shape. Cell. 2000;101(2): Epub 2000/04/ Hartl FU. Molecular chaperones in cellular protein folding. Nature. 1996;381(6583): Epub 1996/06/ Bukau B, Horwich AL. The Hsp70 and Hsp60 chaperone machines. Cell. 1998;92(3): Epub 1998/02/ Folgueira C, Requena JM. A postgenomic view of the heat shock proteins in kinetoplastids. FEMS microbiology reviews. 2007;31(4): Epub 2007/04/ Mayer MP, Bukau B. Hsp70 chaperones: cellular functions and molecular mechanism. Cellular and molecular life sciences : CMLS. 2005;62(6): Epub 2005/03/ Requena JM. The stressful life of pathogenic Leishmania species. In: Requena JM, editor. Stress Response in Microbiology. Norfolk, UK: Caister Academic Press; p Folgueira C, Quijada L, Soto M, Abanades DR, Alonso C, Requena JM. The translational efficiencies of the two Leishmania infantum HSP70 mrnas, differing in their 3'-untranslated regions, are affected by shifts in the temperature of growth through different mechanisms. The Journal of biological chemistry. 2005;280(42): Epub 2005/08/

245 232. Hajjaran H, Azarian B, Mohebali M, Hadighi R, Assareh A, Vaziri B. Comparative proteomics study on meglumine antimoniate sensitive and resistant Leishmania tropica isolated from Iranian anthroponotic cutaneous leishmaniasis patients. Eastern Mediterranean health journal = La revue de sante de la Mediterranee orientale = al-majallah al-sihhiyah li-sharq al-mutawassit. 2012;18(2): Epub 2012/05/ Biyani N, Singh AK, Mandal S, Chawla B, Madhubala R. Differential expression of proteins in antimony-susceptible and -resistant isolates of Leishmania donovani. Molecular and biochemical parasitology. 2011;179(2):91-9. Epub 2011/07/ Drummelsmith J, Girard I, Trudel N, Ouellette M. Differential protein expression analysis of Leishmania major reveals novel roles for methionine adenosyltransferase and S- adenosylmethionine in methotrexate resistance. The Journal of biological chemistry. 2004;279(32): Epub 2004/06/ Brochu C, Haimeur A, Ouellette M. The heat shock protein HSP70 and heat shock cognate protein HSC70 contribute to antimony tolerance in the protozoan parasite leishmania. Cell stress & chaperones. 2004;9(3): Epub 2004/11/ Raina P, Kaur S. Knockdown of LdMC1 and Hsp70 by antisense oligonucleotides causes cell-cycle defects and programmed cell death in Leishmania donovani. Molecular and cellular biochemistry. 2012;359(1-2): Epub 2011/08/ Kim S, Coulombe PA. Emerging role for the cytoskeleton as an organizer and regulator of translation. Nature reviews Molecular cell biology. 2010;11(1): Epub 2009/12/ Gull K. The cytoskeleton of trypanosomatid parasites. Annual review of microbiology. 1999;53: Epub 1999/11/ McKean PG, Vaughan S, Gull K. The extended tubulin superfamily. Journal of cell science. 2001;114(Pt 15): Epub 2001/10/ Werbovetz KA, Brendle JJ, Sackett DL. Purification, characterization, and drug susceptibility of tubulin from Leishmania. Molecular and biochemical parasitology. 1999;98(1): Epub 1999/02/ Werbovetz KA. Tubulin as an antiprotozoal drug target. Mini reviews in medicinal chemistry. 2002;2(6): Epub 2002/10/ Jackson AP, Vaughan S, Gull K. Evolution of tubulin gene arrays in Trypanosomatid parasites: genomic restructuring in Leishmania. BMC genomics. 2006;7:261. Epub 2006/10/ Landfear SM, McMahon-Pratt D, Wirth DF. Tandem arrangement of tubulin genes in the protozoan parasite Leishmania enriettii. Molecular and cellular biology. 1983;3(6): Epub 1983/06/ Tobin JF, Wirth DF. A sequence insertion targeting vector for Leishmania enriettii. The Journal of biological chemistry. 1992;267(7): Epub 1992/03/ Curotto de Lafaille MA, Wirth DF. Creation of Null/+ mutants of the alpha-tubulin gene in Leishmania enriettii by gene cluster deletion. The Journal of biological chemistry. 1992;267(33): Epub 1992/11/ Spithill TW, Samaras N. Genomic organization, chromosomal location and transcription of dispersed and repeated tubulin genes in Leishmania major. Molecular and biochemical parasitology. 1987;24(1): Epub 1987/05/ Joshi M, Dwyer DM, Nakhasi HL. Molecular cloning and characterization of a Leishmania donovani alpha-tubulin gene. The Journal of eukaryotic microbiology. 1995;42(5): Epub 1995/09/

246 248. Fong D, Chang KP. Tubulin biosynthesis in the developmental cycle of a parasitic protozoan, Leishmania mexicana: changes during differentiation of motile and nonmotile stages. Proceedings of the National Academy of Sciences of the United States of America. 1981;78(12): Epub 1981/12/ da Silva RA, Bartholomeu DC, Teixeira SM. Control mechanisms of tubulin gene expression in Trypanosoma cruzi. International journal for parasitology. 2006;36(1): Epub 2005/10/ Urmenyi TP, De Castro FT, Carvalho JF, De Souza W, Rondinelli E. Transcriptional and posttranscriptional control of tubulin gene expression in Trypanosoma cruzi. DNA and cell biology. 1992;11(2): Epub 1992/03/ Landfear SM, Wirth DF. Control of tubulin gene expression in the parasitic protozoan Leishmania enriettii. Nature. 1984;309(5970): Epub 1984/06/ Fong D, Chang KP. Changes in tubulin mrnas during differentiation of a parasitic protozoan Leishmania mexicana. Annals of the New York Academy of Sciences. 1986;466: Epub 1986/01/ Fong D, Wallach M, Keithly J, Melera PW, Chang KP. Differential expression of mrnas for alpha- and beta-tubulin during differentiation of the parasitic protozoan Leishmania mexicana. Proceedings of the National Academy of Sciences of the United States of America. 1984;81(18): Epub 1984/09/ Aravin AA, Yurchenko V, Merzlyak EM, Kolesnikov AA. The mitochondrial ND8 gene from Crithidia oncopelti is not pan-edited. FEBS letters. 1998;431(3): Epub 1998/08/ Ramirez C, Puerta C, Requena JM. Evidence of RNA editing in Leishmania braziliensis promastigotes. Parasitology research. 2011;108(3): Epub 2010/12/ Nocua P, Ramírez C, Requena JM, Puerta CJ. Secuencia parcial del genoma del maxicírculo de Leishmania braziliensis, comparación con otros tripanosomátidos. Universitas Scientiarum. 2011;16: Lambert AJ, Brand MD. Research on mitochondria and aging, Aging cell. 2007;6(4): Epub 2007/07/ Turrens J. More differences in energy metabolism between Trypanosomatidae. Parasitol Today. 1999;15(8): Epub 1999/07/ Tielens AG, Van Hellemond JJ. Differences in energy metabolism between trypanosomatidae. Parasitol Today. 1998;14(7): Epub 2006/10/ Sloof P, Arts GJ, van den Burg J, van der Spek H, Benne R. RNA editing in mitochondria of cultured trypanosomatids: translatable mrnas for NADH-dehydrogenase subunits are missing. Journal of bioenergetics and biomembranes. 1994;26(2): Epub 1994/04/ Opperdoes FR, Michels PA. Complex I of Trypanosomatidae: does it exist? Trends in parasitology. 2008;24(7): Epub 2008/06/ Fang J, Wang Y, Beattie DS. Isolation and characterization of complex I, rotenone-sensitive NADH: ubiquinone oxidoreductase, from the procyclic forms of Trypanosoma brucei. European journal of biochemistry / FEBS. 2001;268(10): Epub 2001/05/ Cermakova P, Verner Z, Man P, Lukes J, Horvath A. Characterization of the NADH:ubiquinone oxidoreductase (complex I) in the trypanosomatid Phytomonas serpens (Kinetoplastida). The FEBS journal. 2007;274(12): Epub 2007/05/ Souza AE, Myler PJ, Stuart K. Maxicircle CR1 transcripts of Trypanosoma brucei are edited and developmentally regulated and encode a putative iron-sulfur protein homologous to an NADH dehydrogenase subunit. Molecular and cellular biology. 1992;12(5): Epub 1992/05/

247 265. Gerasimov ES, Kostygov AY, Yan S, Kolesnikov AA. From cryptogene to gene? ND8 editing domain reduction in insect trypanosomatids. European journal of protistology. 2012;48(3): Epub 2011/10/ Merzlyak EM, Zakharova MY, Kolesnikov AA. Monogenetic trypanosomatids: comparison of the ND8 editing gene. European journal of protistology. 2001;37(2): Romero Peñuela M, Sánchez Valencia JA. Una mirada a la epidemiología y al control de la leishmaniasis zoonótica en Colombia A glance on the epidemiology and zoonotic leishmaniasis control in Colombia. Biosalud. 2007(6): Velez ID, Hendrickx E, Robledo SM, Agudelo SdP. Leishmaniosis cutánea en Colombia y género. Cadernos de saude publica. 2001;17: Ovalle CE, Porras L, Rey M, Ríos M, Camargo YC. Distribución geográfica de especies de Leishmania aisladas de pacientes consultantes al Instituto Nacional de Dermatología Federico Lleras Acosta, E.S.E., Biomédica. 2006;26: Deflorin J, Rudolf M, Seebeck T. The major components of the paraflagellar rod of Trypanosoma brucei are two similar, but distinct proteins which are encoded by two different gene loci. The Journal of biological chemistry. 1994;269(46): Epub 1994/11/ Bermudez R, Dagger F, D'Aquino JA, Benaim G, Dawidowicz K. Characterization of mitochondrial electron-transfer in Leishmania mexicana. Molecular and biochemical parasitology. 1997;90(1): Epub 1998/03/ Rey-Ladino JA, Reiner NE. Expression of 65- and 67-kilodalton heat-regulated proteins and a 70-kilodalton heat shock cognate protein of Leishmania donovani in macrophages. Infection and immunity. 1993;61(8): Epub 1993/08/ Rastrojo A, Carrasco-Ramiro F, Martin D, Crespillo A, Reguera RM, Aguado B, et al. The transcriptome of Leishmania major in the axenic promastigote stage: transcript annotation and relative expression levels by RNA-seq. BMC genomics. 2013;14(1):223. Epub 2013/04/ Leprohon P, Legare D, Raymond F, Madore E, Hardiman G, Corbeil J, et al. Gene expression modulation is associated with gene amplification, supernumerary chromosomes and chromosome loss in antimony-resistant Leishmania infantum. Nucleic acids research. 2009;37(5): Epub 2009/01/ Ubeda JM, Legare D, Raymond F, Ouameur AA, Boisvert S, Rigault P, et al. Modulation of gene expression in drug resistant Leishmania is associated with gene amplification, gene deletion and chromosome aneuploidy. Genome biology. 2008;9(7):R115. Epub 2008/07/ Horn D. Codon usage suggests that translational selection has a major impact on protein expression in trypanosomatids. BMC genomics. 2008;9:2. Epub 2008/01/ Kelly BL, Nelson TN, McMaster WR. Stage-specific expression in Leishmania conferred by 3' untranslated regions of L. major leishmanolysin genes (GP63). Molecular and biochemical parasitology. 2001;116(1): Epub 2001/07/ Voth BR, Kelly BL, Joshi PB, Ivens AC, McMaster WR. Differentially expressed Leishmania major gp63 genes encode cell surface leishmanolysin with distinct signals for glycosylphosphatidylinositol attachment. Molecular and biochemical parasitology. 1998;93(1): Epub 1998/07/ Jackson AP, Vaughan S, Gull K. Comparative genomics and concerted evolution of betatubulin paralogs in Leishmania spp. BMC genomics. 2006;7:137. Epub 2006/06/

248 280. Shapira M, Pedraza G. Sequence analysis and transcriptional activation of heat shock protein 83 of Leishmania mexicana amazonensis. Molecular and biochemical parasitology. 1990;42(2): Epub 1990/09/ Soto M, Quijada L, Larreta R, Iborra S, Alonso C, Requena JM. Leishmania infantum possesses a complex family of histone H2A genes: structural characterization and analysis of expression. Parasitology. 2003;127(Pt 2): Epub 2003/09/ Ramirez CA, Requena JM, Puerta CJ. Identification of the HSP70-II gene in Leishmania braziliensis HSP70 locus: genomic organization and UTRs characterization. Parasites & vectors. 2011;4:166. Epub 2011/08/ LeBowitz JH, Smith HQ, Rusche L, Beverley SM. Coupling of poly(a) site selection and transsplicing in Leishmania. Genes & development. 1993;7(6): Epub 1993/06/ Jager AV, De Gaudenzi JG, Cassola A, D'Orso I, Frasch AC. mrna maturation by two-step trans-splicing/polyadenylation processing in trypanosomes. Proceedings of the National Academy of Sciences of the United States of America. 2007;104(7): Epub 2007/02/ Scholler JK, Reed SG, Stuart K. Molecular karyotype of species and subspecies of Leishmania. Molecular and biochemical parasitology. 1986;20(3): Epub 1986/09/ Giannini SH, Schittini M, Keithly JS, Warburton PW, Cantor CR, Van der Ploeg LH. Karyotype analysis of Leishmania species and its use in classification and clinical diagnosis. Science. 1986;232(4751): Epub 1986/05/ Gao G, Kapushoc ST, Simpson AM, Thiemann OH, Simpson L. Guide RNAs of the recently isolated LEM125 strain of Leishmania tarentolae: an unexpected complexity. RNA. 2001;7(9): Epub 2001/09/ Thiemann OH, Maslov DA, Simpson L. Disruption of RNA editing in Leishmania tarentolae by the loss of minicircle-encoded guide RNA genes. The EMBO journal. 1994;13(23): Epub 1994/12/ Ramírez. C, Requena. JM, Puerta. CJ. XIV Congreso Colombiano de Parasitología y Medicina Tropical. In: INS, editor. Determinación de las regiones 5 y 3 no traducidas de los genes alfa tubulina de Lesihmania braziliensis; Octubre 8 al 11; Medellín. Colombia: Biomédica, vol 29 (Supl.1); 164; Baumeister H. RNA-Protein Interactions. Edited by K. Nagai and I. W. Mattaj. XVIII and 272 pages, numerous figures and tables. IRL Press at Oxford University Press, Oxford, New York, Tokio Price: Food / Nahrung. 1997;41(4): Parish JH. Principles of nucleic acid structure: By W Saenger. pp 556. Springer-Verlag, New York DM 79. ISBN Biochemical Education. 1985;13(2): Di Noia JM, D'Orso I, Sanchez DO, Frasch AC. AU-rich elements in the 3'-untranslated region of a new mucin-type gene family of Trypanosoma cruzi confers mrna instability and modulates translation efficiency. The Journal of biological chemistry. 2000;275(14): Epub 2000/04/ Makeyev AV, Liebhaber SA. The poly(c)-binding proteins: a multiplicity of functions and a search for mechanisms. RNA. 2002;8(3): Epub 2002/05/ Rosenzweig D, Smith D, Myler PJ, Olafson RW, Zilberstein D. Post-translational modification of cellular proteins during Leishmania donovani differentiation. Proteomics. 2008;8(9): Epub 2008/04/ Morales MA, Watanabe R, Dacher M, Chafey P, Osorio y Fortea J, Scott DA, et al. Phosphoproteome dynamics reveal heat-shock protein complexes specific to the Leishmania 248

249 donovani infectious stage. Proceedings of the National Academy of Sciences of the United States of America. 2010;107(18): Epub 2010/04/ Ebikeme C, Hubert J, Biran M, Gouspillou G, Morand P, Plazolles N, et al. Ablation of succinate production from glucose metabolism in the procyclic trypanosomes induces metabolic switches to the glycerol 3-phosphate/dihydroxyacetone phosphate shuttle and to proline metabolism. The Journal of biological chemistry. 2010;285(42): Epub 2010/08/ Michels PA, Bringaud F, Herman M, Hannaert V. Metabolic functions of glycosomes in trypanosomatids. Biochimica et biophysica acta. 2006;1763(12): Epub 2006/10/ Hellemond JJ, Bakker BM, Tielens AG. Energy metabolism and its compartmentation in Trypanosoma brucei. Advances in microbial physiology. 2005;50: Epub 2005/10/ Koslowsky DJ, Riley GR, Feagin JE, Stuart K. Guide RNAs for transcripts with developmentally regulated RNA editing are present in both life cycle stages of Trypanosoma brucei. Molecular and cellular biology. 1992;12(5): Epub 1992/05/ Opperdoes FR, Coombs GH. Metabolism of Leishmania: proven and predicted. Trends in parasitology. 2007;23(4): Epub 2007/02/ Koslowsky DJ, Bhat GJ, Read LK, Stuart K. Cycles of progressive realignment of grna with mrna in RNA editing. Cell. 1991;67(3): Epub 1991/11/ Ochsenreiter T, Cipriano M, Hajduk SL. Alternative mrna editing in trypanosomes is extensive and may contribute to mitochondrial protein diversity. PloS one. 2008;3(2):e1566. Epub 2008/02/ Clos J, Krobitsch. S. Heat Shock as a Regular Feature of the Life Cycle of Leishmania Parasites. American Zoologist. 1999;39: Richter K, Haslbeck M, Buchner J. The heat shock response: life on the verge of death. Molecular cell. 2010;40(2): Epub 2010/10/ Morimoto RI, Sarge KD, Abravaya K. Transcriptional regulation of heat shock genes. A paradigm for inducible genomic responses. The Journal of biological chemistry. 1992;267(31): Epub 1992/11/ Haile S, Papadopoulou B. Developmental regulation of gene expression in trypanosomatid parasitic protozoa. Current opinion in microbiology. 2007;10(6): Epub 2008/01/ Keene JD. RNA regulons: coordination of post-transcriptional events. Nature reviews Genetics. 2007;8(7): Epub 2007/06/ Kobe B, Kajava AV. The leucine-rich repeat as a protein recognition motif. Current opinion in structural biology. 2001;11(6): Epub 2001/12/ Caspary F, Seraphin B. The yeast U2A'/U2B complex is required for pre-spliceosome formation. The EMBO journal. 1998;17(21): Epub 1998/11/ Gunzl A. The pre-mrna splicing machinery of trypanosomes: complex or simplified? Eukaryotic cell. 2010;9(8): Epub 2010/06/ Preusser C, Palfi Z, Bindereif A. Special Sm core complex functions in assembly of the U2 small nuclear ribonucleoprotein of Trypanosoma brucei. Eukaryotic cell. 2009;8(8): Epub 2009/06/ Price SR, Evans PR, Nagai K. Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA. Nature. 1998;394(6694): Epub 1998/08/ Cross M, Wieland B, Palfi Z, Gunzl A, Rothlisberger U, Lahm HW, et al. The transspliceosomal U2 snrnp protein 40K of Trypanosoma brucei: cloning and analysis of functional 249

250 domains reveals homology to a mammalian snrnp protein. The EMBO journal. 1993;12(3): Epub 1993/03/ Gupta SK, Carmi S, Waldman Ben-Asher H, Tkacz ID, Naboishchikov I, Michaeli S. Basal splicing factors regulate the stability of mature mrnas in trypanosomes. The Journal of biological chemistry. 2013;288(7): Epub 2013/01/ Neer EJ, Schmidt CJ, Nambudripad R, Smith TF. The ancient regulatory-protein family of WD-repeat proteins. Nature. 1994;371(6495): Epub 1994/09/ Smith TF, Gaitatzes C, Saxena K, Neer EJ. The WD repeat: a common architecture for diverse functions. Trends in biochemical sciences. 1999;24(5): Epub 1999/05/ Vander Kooi CW, Ren L, Xu P, Ohi MD, Gould KL, Chazin WJ. The Prp19 WD40 domain contains a conserved protein interaction region essential for its function. Structure. 2010;18(5): Epub 2010/05/ Bjorn SP, Soltyk A, Beggs JD, Friesen JD. PRP4 (RNA4) from Saccharomyces cerevisiae: its gene product is associated with the U4/U6 small nuclear ribonucleoprotein particle. Molecular and cellular biology. 1989;9(9): Epub 1989/09/ Vaisman N, Tsouladze A, Robzyk K, Ben-Yehuda S, Kupiec M, Kassir Y. The role of Saccharomyces cerevisiae Cdc40p in DNA replication and mitotic spindle formation and/or maintenance. Molecular & general genetics : MGG. 1995;247(2): Epub 1995/04/ de Hostos EL, Bradtke B, Lottspeich F, Guggenheim R, Gerisch G. Coronin, an actin binding protein of Dictyostelium discoideum localized to cell surface projections, has sequence similarities to G protein beta subunits. The EMBO journal. 1991;10(13): Epub 1991/12/ Pryer NK, Salama NR, Schekman R, Kaiser CA. Cytosolic Sec13p complex is required for vesicle formation from the endoplasmic reticulum in vitro. The Journal of cell biology. 1993;120(4): Epub 1993/02/ Adams DR, Ron D, Kiely PA. RACK1, A multifaceted scaffolding protein: Structure and function. Cell communication and signaling : CCS. 2011;9:22. Epub 2011/10/ Feldman RM, Correll CC, Kaplan KB, Deshaies RJ. A complex of Cdc4p, Skp1p, and Cdc53p/cullin catalyzes ubiquitination of the phosphorylated CDK inhibitor Sic1p. Cell. 1997;91(2): Epub 1997/11/ Chan SP, Kao DI, Tsai WY, Cheng SC. The Prp19p-associated complex in spliceosome activation. Science. 2003;302(5643): Epub 2003/09/ Chen HC, Cheng SC. Functional roles of protein splicing factors. Bioscience reports. 2012;32(4): Epub 2012/07/ da Costa Lima TD, Moura DM, Reis CR, Vasconcelos JR, Ellis L, Carrington M, et al. Functional characterization of three leishmania poly(a) binding protein homologues with distinct binding properties to RNA and protein partners. Eukaryotic cell. 2010;9(10): Epub 2010/08/ Mangus DA, Evans MC, Jacobson A. Poly(A)-binding proteins: multifunctional scaffolds for the post-transcriptional control of gene expression. Genome biology. 2003;4(7):223. Epub 2003/07/ Mittra B, Ray DS. Presence of a poly(a) binding protein and two proteins with cell cycledependent phosphorylation in Crithidia fasciculata mrna cycling sequence binding protein II. Eukaryotic cell. 2004;3(5): Epub 2004/10/ Cushman I, Bowman BR, Sowa ME, Lichtarge O, Quiocho FA, Moore MS. Computational and biochemical identification of a nuclear pore complex binding site on the nuclear transport carrier NTF2. Journal of molecular biology. 2004;344(2): Epub 2004/11/

251 330. Song J, McGivern JV, Nichols KW, Markley JL, Sheets MD. Structural basis for RNA recognition by a type II poly(a)-binding protein. Proceedings of the National Academy of Sciences of the United States of America. 2008;105(40): Epub 2008/10/ Neto JL, Lira CB, Giardini MA, Khater L, Perez AM, Peroni LA, et al. Leishmania replication protein A-1 binds in vivo single-stranded telomeric DNA. Biochemical and biophysical research communications. 2007;358(2): Epub 2007/05/ Scherrer T, Femmer C, Schiess R, Aebersold R, Gerber AP. Defining potentially conserved RNA regulons of homologous zinc-finger RNA-binding proteins. Genome biology. 2011;12(1):R3. Epub 2011/01/ Chamberlain JR, Lee Y, Lane WS, Engelke DR. Purification and characterization of the nuclear RNase P holoenzyme complex reveals extensive subunit overlap with RNase MRP. Genes & development. 1998;12(11): Epub 1998/06/ Aravind L, Iyer LM, Anantharaman V. The two faces of Alba: the evolutionary connection between proteins participating in chromatin structure and RNA metabolism. Genome biology. 2003;4(10):R64. Epub 2003/10/ Fetzer CP, Hogan DJ, Lipps HJ. A PIWI homolog is one of the proteins expressed exclusively during macronuclear development in the ciliate Stylonychia lemnae. Nucleic acids research. 2002;30(20): Epub 2002/10/ Stolc V, Katz A, Altman S. Rpp2, an essential protein subunit of nuclear RNase P, is required for processing of precursor trnas and 35S precursor rrna in Saccharomyces cerevisiae. Proceedings of the National Academy of Sciences of the United States of America. 1998;95(12): Epub 1998/06/ Crnigoj M, Podlesek Z, Zorko M, Jerala R, Anderluh G, Ulrih NP. Interactions of archaeal chromatin proteins Alba1 and Alba2 with nucleic acids. PloS one. 2013;8(2):e Epub 2013/03/ Mani J, Guttinger A, Schimanski B, Heller M, Acosta-Serrano A, Pescher P, et al. Albadomain proteins of Trypanosoma brucei are cytoplasmic RNA-binding proteins that interact with the translation machinery. PloS one. 2011;6(7):e Epub 2011/08/ Mair GR, Lasonder E, Garver LS, Franke-Fayard BM, Carret CK, Wiegant JC, et al. Universal features of post-transcriptional gene regulation are critical for Plasmodium zygote development. PLoS pathogens. 2010;6(2):e Epub 2010/02/ Subota I, Rotureau B, Blisnick T, Ngwabyt S, Durand-Dubief M, Engstler M, et al. ALBA proteins are stage regulated during trypanosome development in the tsetse fly and participate in differentiation. Molecular biology of the cell. 2011;22(22): Epub 2011/10/ Yang Q, Jankowsky E. ATP- and ADP-dependent modulation of RNA unwinding and strand annealing activities by the DEAD-box protein DED1. Biochemistry. 2005;44(41): Epub 2005/10/ Gingras AC, Raught B, Sonenberg N. eif4 initiation factors: effectors of mrna recruitment to ribosomes and regulators of translation. Annual review of biochemistry. 1999;68: Epub 2000/06/ Dhalia R, Reis CR, Freire ER, Rocha PO, Katz R, Muniz JR, et al. Translation initiation in Leishmania major: characterisation of multiple eif4f subunit homologues. Molecular and biochemical parasitology. 2005;140(1): Epub 2005/02/ Barhoumi M, Tanner NK, Banroques J, Linder P, Guizani I. Leishmania infantum LeIF protein is an ATP-dependent RNA helicase and an eif4a-like factor that inhibits translation in yeast. The FEBS journal. 2006;273(22): Epub 2006/11/

252 345. Beckham C, Hilliker A, Cziko AM, Noueiry A, Ramaswami M, Parker R. The DEAD-box RNA helicase Ded1p affects and accumulates in Saccharomyces cerevisiae P-bodies. Molecular biology of the cell. 2008;19(3): Epub 2007/12/ Ramírez CA, Dea-Ayuela MA, Bolas-Fernández F, Requena JM, Puerta CJ. Identification of HSP70-RNA messenger interacting proteins in Leishmania braziliensis. Journal of proteomics. 2013;Submitted Hilliker A, Gao Z, Jankowsky E, Parker R. The DEAD-box protein Ded1 modulates translation by the formation and resolution of an eif4f-mrna complex. Molecular cell. 2011;43(6): Epub 2011/09/ Hinnebusch AG. eif3: a versatile scaffold for translation initiation complexes. Trends in biochemical sciences. 2006;31(10): Epub 2006/08/ Mayeur GL, Fraser CS, Peiretti F, Block KL, Hershey JW. Characterization of eif3k: a newly discovered subunit of mammalian translation initiation factor elf3. European journal of biochemistry / FEBS. 2003;270(20): Epub 2003/10/ Wei Z, Zhang P, Zhou Z, Cheng Z, Wan M, Gong W. Crystal structure of human eif3k, the first structure of eif3 subunits. The Journal of biological chemistry. 2004;279(33): Epub 2004/06/ Singh CR, Watanabe R, Zhou D, Jennings MD, Fukao A, Lee B, et al. Mechanisms of translational regulation by a human eif5-mimic protein. Nucleic acids research. 2011;39(19): Epub 2011/07/ Mittal N, Subramanian G, Butikofer P, Madhubala R. Unique posttranslational modifications in eukaryotic translation factors and their roles in protozoan parasite viability and pathogenesis. Molecular and biochemical parasitology. 2013;187(1): Epub 2012/12/ Mateyak MK, Kinzy TG. eef1a: thinking outside the ribosome. The Journal of biological chemistry. 2010;285(28): Epub 2010/05/ Noble CG, Song H. Structural studies of elongation and release factors. Cellular and molecular life sciences : CMLS. 2008;65(9): Epub 2008/01/ Justice MC, Hsu MJ, Tse B, Ku T, Balkovec J, Schmatz D, et al. Elongation factor 2 as a novel target for selective inhibition of fungal protein synthesis. The Journal of biological chemistry. 1998;273(6): Epub 1998/03/ Decker CJ, Parker R. P-bodies and stress granules: possible roles in the control of translation and mrna degradation. Cold Spring Harbor perspectives in biology. 2012;4(9):a Epub 2012/07/ Parker R, Sheth U. P bodies and the control of mrna translation and degradation. Molecular cell. 2007;25(5): Epub 2007/03/ Cassola A. RNA Granules Living a Post-transcriptional Life: the Trypanosomes' Case. Current chemical biology. 2011;5(2): Epub 2011/09/ Cassola A, De Gaudenzi JG, Frasch AC. Recruitment of mrnas to cytoplasmic ribonucleoprotein granules in trypanosomes. Molecular microbiology. 2007;65(3): Epub 2007/07/ Cougot N, Babajko S, Seraphin B. Cytoplasmic foci are sites of mrna decay in human cells. The Journal of cell biology. 2004;165(1): Epub 2004/04/ Anderson P, Kedersha N. RNA granules. The Journal of cell biology. 2006;172(6): Epub 2006/03/

253 362. Kedersha N, Stoecklin G, Ayodele M, Yacono P, Lykke-Andersen J, Fritzler MJ, et al. Stress granules and processing bodies are dynamically linked sites of mrnp remodeling. The Journal of cell biology. 2005;169(6): Epub 2005/06/ Wilczynska A, Aigueperse C, Kress M, Dautry F, Weil D. The translational regulator CPEB1 provides a link between dcp1 bodies and stress granules. Journal of cell science. 2005;118(Pt 5): Epub 2005/02/ Kramer S, Queiroz R, Ellis L, Webb H, Hoheisel JD, Clayton C, et al. Heat shock causes a decrease in polysomes and the appearance of stress granules in trypanosomes independently of eif2(alpha) phosphorylation at Thr169. Journal of cell science. 2008;121(Pt 18): Epub 2008/08/ Kedersha N, Anderson P. Mammalian stress granules and processing bodies. Methods in enzymology. 2007;431: Epub 2007/10/ Kimball SR, Horetsky RL, Ron D, Jefferson LS, Harding HP. Mammalian stress granules represent sites of accumulation of stalled translation initiation complexes. American journal of physiology Cell physiology. 2003;284(2):C Epub 2002/10/ Kedersha N, Chen S, Gilks N, Li W, Miller IJ, Stahl J, et al. Evidence that ternary complex (eif2-gtp-trna(i)(met))-deficient preinitiation complexes are core constituents of mammalian stress granules. Molecular biology of the cell. 2002;13(1): Epub 2002/01/ Janssens V, Goris J. Protein phosphatase 2A: a highly regulated family of serine/threonine phosphatases implicated in cell growth and signalling. The Biochemical journal. 2001;353(Pt 3): Epub 2001/02/ Ding XZ, Tsokos GC, Kiang JG. Overexpression of HSP-70 inhibits the phosphorylation of HSF1 by activating protein phosphatase and inhibiting protein kinase C activity. FASEB journal : official publication of the Federation of American Societies for Experimental Biology. 1998;12(6): Epub 1998/04/ Pais SM, Tellez-Inon MT, Capiati DA. Serine/threonine protein phosphatases type 2A and their roles in stress signaling. Plant signaling & behavior. 2009;4(11): Epub 2009/12/ Gonzalez J, Cornejo A, Santos MR, Cordero EM, Gutierrez B, Porcile P, et al. A novel protein phosphatase 2A (PP2A) is involved in the transformation of human protozoan parasite Trypanosoma cruzi. The Biochemical journal. 2003;374(Pt 3): Epub 2003/05/ Wek RC, Jiang HY, Anthony TG. Coping with stress: eif2 kinases and translational control. Biochemical Society transactions. 2006;34(Pt 1):7-11. Epub 2005/10/ Chow C, Cloutier S, Dumas C, Chou MN, Papadopoulou B. Promastigote to amastigote differentiation of Leishmania is markedly delayed in the absence of PERK eif2alpha kinasedependent eif2alpha phosphorylation. Cellular microbiology. 2011;13(7): Epub 2011/06/ Cloutier S, Laverdiere M, Chou MN, Boilard N, Chow C, Papadopoulou B. Translational control through eif2alpha phosphorylation during the Leishmania differentiation process. PloS one. 2012;7(5):e Epub 2012/06/ Jackson RJ, Hellen CU, Pestova TV. The mechanism of eukaryotic translation initiation and principles of its regulation. Nature reviews Molecular cell biology. 2010;11(2): Epub 2010/01/ Svitkin YV, Sonenberg N. [Translational control by the poly(a) binding protein: a check for mrna integrity]. Molekuliarnaia biologiia. 2006;40(4): Epub 2006/08/

254 377. Wilson GM, Sutphen K, Bolikal S, Chuang KY, Brewer G. Thermodynamics and kinetics of Hsp70 association with A + U-rich mrna-destabilizing sequences. The Journal of biological chemistry. 2001;276(48): Epub 2001/10/ Kishor A, Tandukar B, Ly YV, Toth EA, Suarez Y, Brewer G, et al. Hsp70 is a novel posttranscriptional regulator of gene expression that binds and stabilizes selected mrnas containing AU-rich elements. Molecular and cellular biology. 2013;33(1): Epub 2012/10/ Ullah H, Scappini EL, Moon AF, Williams LV, Armstrong DL, Pedersen LC. Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana. Protein science : a publication of the Protein Society. 2008;17(10): Epub 2008/08/ McCahill A, Warwicker J, Bolger GB, Houslay MD, Yarwood SJ. The RACK1 scaffold protein: a dynamic cog in cell response mechanisms. Molecular pharmacology. 2002;62(6): Epub 2002/11/ Guo J, Wang J, Xi L, Huang WD, Liang J, Chen JG. RACK1 is a negative regulator of ABA responses in Arabidopsis. Journal of experimental botany. 2009;60(13): Epub 2009/07/ Guo J, Wang S, Valerius O, Hall H, Zeng Q, Li JF, et al. Involvement of Arabidopsis RACK1 in protein translation and its regulation by abscisic acid. Plant physiology. 2011;155(1): Epub 2010/11/ Nilsson J, Sengupta J, Frank J, Nissen P. Regulation of eukaryotic translation by the RACK1 protein: a platform for signalling molecules on the ribosome. EMBO reports. 2004;5(12): Epub 2004/12/ Ceci M, Gaviraghi C, Gorrini C, Sala LA, Offenhauser N, Marchisio PC, et al. Release of eif6 (p27bbp) from the 60S subunit allows 80S ribosome assembly. Nature. 2003;426(6966): Epub 2003/12/ Shor B, Calaycay J, Rushbrook J, McLeod M. Cpc2/RACK1 is a ribosome-associated protein that promotes efficient translation in Schizosaccharomyces pombe. The Journal of biological chemistry. 2003;278(49): Epub 2003/09/ Tsvetanova NG, Klass DM, Salzman J, Brown PO. Proteome-wide search reveals unexpected RNA-binding proteins in Saccharomyces cerevisiae. PloS one. 2010;5(9). Epub 2010/09/ Scherrer T, Mittal N, Janga SC, Gerber AP. A screen for RNA-binding proteins in yeast indicates dual functions for many enzymes. PloS one. 2010;5(11):e Epub 2010/12/ Hentze MW, Preiss T. The REM phase of gene regulation. Trends in biochemical sciences. 2010;35(8): Epub 2010/06/ Ciesla J. Metabolic enzymes that bind RNA: yet another level of cellular regulatory network? Acta biochimica Polonica. 2006;53(1): Epub 2006/01/ Collingridge PW, Brown RW, Ginger ML. Moonlighting enzymes in parasitic protozoa. Parasitology. 2010;137(9): Epub 2010/03/ Vanegas G, Quinones W, Carrasco-Lopez C, Concepcion JL, Albericio F, Avilan L. Enolase as a plasminogen binding protein in Leishmania mexicana. Parasitology research. 2007;101(6): Epub 2007/07/ Joice AC, Lyda TL, Sayce AC, Verplaetse E, Morris MT, Michels PA, et al. Extra-glycosomal localisation of Trypanosoma brucei hexokinase 2. International journal for parasitology. 2012;42(4): Epub 2012/05/ Sbicego S, Alfonzo JD, Estevez AM, Rubio MA, Kang X, Turck CW, et al. RBP38, a novel RNAbinding protein from trypanosomatid mitochondria, modulates RNA stability. Eukaryotic cell. 2003;2(3): Epub 2003/06/

255 13. ANEXOS ANEXO 1. FIGURAS SUPLEMENTARIAS ARTICULO No

256 256

257 257

258 13.2. ANEXO 2. FIGURAS SUPLEMENTARIAS ARTICULO No. 2 A B 28IGR TTCCGTTGGTAGAGGGGAGCTAAAGGGAGTACGAGTGCCACCTCTTTACTTCCCCTCTGCCTCCTCCC ::: ::: :: ::: ::: ::: : : :: : :: :::: : at0210 ATGCGTGAGGCTATCTGCATTCACATCGGCCAGGCCGGCTGCCAGGTCGGTAACGCGTGCTGGGAGCTCTTCTGCCTTGAGCACGGCATCCAGCCCG--ACGGCTCCATGCCCTCTGACA 28IGR CTAGCATTGTTGCTGCTGCTGCTGCTGCTGCTATGCTTTGTGCCTGCGCATCTATGCGGGAATAGATGAGTGCGTGCTTACTGG-CATAGGCGAGGATTCGTGTTTCGTTACTGACGCTA :::::: :: :: : :: :: : : : : :: : : : : : :: :: :: : : ::: :: : : : : :: : :::: :::: at0210 AGTGCATTGGTGTTGAGGATGACGCG--TTCAACACCTTCTTCTCGGAGACCGGAGCTGGCA-AGCACGTTCCTCGCTCCCTCTTCCTGGACCTCGAGCCCACGGTCGTG---GACG--- 28IGR CCACGATCGATAGGGGGAGGGACGGGGGAGGGGGTAAAACGCGTTTA-CTTTTGTATGTGCACGTCTGTGTAGAGGAGCGTGGACCTTCATTCAC-CTGCACTTCC--CCACGACACCGC : : :: ::: : : :: : :: : : :: : :: : :: ::: :: : :: : : : :: : :: :: : : :: ::: : : : :: : :: at AGGTGCGCACTGGGAACGTACCGCC-AGCTGTTCAACCCCGAGCAGCTGGTGTCTG-GCAAGGAGGATGCGGCGAACAACTACGCTCGTGGTCACTACACGATCGGCAAGGAGATCGT 28IGR ---CCCACCAGCCCCTCTCCCTCCCTCCCTCCCTCCGTGTCTCTTGCGGCATGTGCGTGCGTCTGTGGTGGTGCCAATTCCATCTCCCGAAGTACTCCGCACATCCGGTGTCCCTCTTAC ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: at0210 GGACCCACCAGCCCCTCTCCCTCCCTCCCTCCCTCCGTGTCTCTTGCGGCATGTGCGTGCGTCTGTGGTGGTGCCAATTCCATCTCCCGAAGTACTCCGCACATCCGGTGTCCCTCTTAC 28IGR TTTGTTGCTTCCTTACGATTCTTAACCCCTCACACTTGTAGGCTGTTGTGCGTGCGTGTGGCTGCCCACTTCATCACGCCTCCACCAACTCTCGCACCGCGCCGCCAAAGGCCGCCGTTG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: at0210 TTTGTTGCTTCCTTACGATTCTTAACCCCTCACACTTGTAGGCTGTTGTGCGTGCGTGTGGCTGCCCACTTCATCACGCCTCCACCAACTCTCGCACCGCGCCGCCAAAGGCCGCCGTTG 28IGR CACACGCACTCCTTTTCGTATTGTGAGGCGGTCAGTGCACAGAGGGGGGAGGGAGGAAGAGAGGCAGAGACACATGCTGTCGCACCCTTATTCTCCTCGTCATGCGTTTCGGCCTAGCCA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: at0210 CACACGCACTCCTTTTCGTATTGTGAGGCGGTCAGTGCACAGAGGGGGGAGGGAGGAAGAGAGGCAGAGACACATGCTGTCGCACCCTTATTCTCCTCGTCATGCGTTTCGGCCTAGCCA 28IGR CACCTCACCGGCATACGAATAAACTACGCTGGGGCGCGTTCATCTTTGTGTCGATCTCTGTTGTGTTCTTTCCCCTTCATAGCCGCACACACACACACAC CT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :: at0210 CACCTCACCGGCATACGAATAAACTACGCTGGGGCGCGTTCATCTTTGTGTCGATCTCTGTTGTGTTCTTTCCCCTTCATAGCCGCACACACACACACACACACACACACACACACACCT 28IGR GCC-GTTACAGTGCACTGCACGCACTTCCCGA-GCTCCCCACTTTATTTCTTCTCCACGCGCAAAGAGGCACGCTGCTGTGCATCGCGTGCGTGTGTGCGATCGTCTCTCTTCGCCGCTT ::: : :: : :::::::: : : : :::::::::::::::::::::::: :::::::: : :: :::: :::: : : at0210 GCCCGATAAAATGCACTGCGGGGGGGGGGGAAAGAACCCCACTTTATTTCTTCTCCACGCACAAAGAGGAAAGCAGCTGAACATCAGGAG IGR TAGACCTCCTTGTGCATACCTCTCTCTGCGTGTGTCTTTCCTTTGTTTCTCCCCTAAAGT at Chromosome 28 ( ) Chromosome 13 ( ) Additional Figure S1. 258

259 13.3. ANEXO 3. FIGURAS SUPLEMENTARIAS ARTICULO No. 4 1 TACACTGTAT TGATATTTAC AATACAATAT ACTTAATTTA AATGGAATTT 51 TATTATGATT AAATATAATA CATATTAATA TCATTTTAAT AAAATATTCA 101 TTTTTAATAT TATTAAATAA TTTAGAATAT TTAATTATAT CAAACATTTA 151 AATTTATTAT AATCTATATA AAAAAGATGT TAAGTTTTCG GTTTTGAAAA 201 GAGAGGAGAG ATTTGAGGGA GAGTTTTTTG AAGGGAGTTT TGAGAAAAGA 251 CTAGAGAAGA AGAAGAGTTT TTGGGGCGAG ATTATTTAGT TTTAGAAAGC 301 GAGTAAGGAA AGAGGGGAGA GAGAGCGAGA TTGAACGGAT TAGGATTTTG 351 GGAGGGAAGA GACACCGAGG ATTTTTGAGG GAGAAAAACC ATTTGGGAAT 401 AAATTTAGAG GGGAAGAAGG GAGCCGCATT TTTTGGGAAA TTTCAATTTG 451 CAAAAAAATT ATTTTTTATT TTATTTTTAA AAGTTTTTCG ATAATTAAAA 501 TTTCTTTTTT ATTGTTAAAG CAAACTCATA AAAATTTCTC GAAAATTTTT 551 CCCTTCAAAA AAAATCTCCC AAAAAACTAC TTTGGAAATG CAAACTTCTG 601 GCCCCCTCCT GTGTGATTAG CAAAGAAATC AAAAGGTTGG ACCTGCTCCC 651 CTTCCGAAAA CGATCTTTTC TTCAGTCGAT CCAAAACTCT TCTCCCGCTC 701 TAAAGCTCTA GGGCATTTCC TCGACGGCTC CGTTCCCCCA ATCAAAATCG 751 CTGATTCCCG AAACCTCTCT GGTTCTCCTG GTCCGAAAAA TCCCTCCTTC 801 CGAAAAAACT CTCTTTTACA TATAATTATT AAAAACACTA AAATTATAAA 851 CTAATTAAGT TCTAAATAAT AAAAAAAATA ATAAAGATTT GATGTGGAAA 901 AATATATTTT TATAAATATA TTAATTACTG CACGTTGTCT TTATTACAAA 951 GAATGGTGGG CAACAATACC TTCTAAATTT ATTGTTTTAT CTAAACATGC 1001 TAATTTAATA TAATAAATTA ATTTTGATTA TAAAATTTAC AATTTCATTT 1051 ATAATCCTTA TCATGTTGTC AAAAACAATA AATAGATATT GTCGACTTAA 1101 ATGAATAAAT ATAATATAAT ATAATTAATA ATTAATAGCA TTATTTATTT 1151 GCATATACCA TATGGTGTAT AAAAACAAAT AAAAAAAATA TATTTTTTTA 1201 TTGACTAAAA TTAATTCAGT AACAAATTTA TAAAATAAAT GTATAATATT 1251 TAAAAGCATA GAAATTACCG CAACGGCTGG CATCCATTTC TGACTAATAA 1301 TTTAATTTAA TTTATTATAT TTATTTATAT AAAATTTATT ACTTTTTCCA 1351 CACCCCTTTA ATAGCATTAA CAAAAAAATC TAATCAGAAT TATAAATTAT 1401 TATTAACTAT TCCTAAAATT TGAAAATACA TTTATCTTTT TAAATCAAAT 1451 AAACTAATAT AAAATTAAAA AACTTTTAAA AAAATTAATA TGAATAATAA 1501 CAATTGACTT TTAATATTTT TTAAAATAAA ATAAAATAAA ATAAAATAAA 1551 ATAAAATAAA ATAAAATAAA ATAACAAATA ATAGATCCTT GCGTACTGAT 1601 ATTAATTTTT AATGATATAT AAAAATTAAA TATATAAACA AATCTGCTTT 1651 ACAACGATTT TAACCCAACT AACGAATTGC ATTTTTGATG AACAATCAAT 1701 TTAAATTAGC AATAAGTAGA CGATGAAACA CATTTATTAT TAATGCTTGT 1751 TAACCTGCTC GAACCTTTTA TTATTTCAAT AATTATAGTT CTTTTTCTAT 1801 ATAAATAGAT ATAGTATTGC CCCAATCAAA CATACAAATA CATATAAATG 1851 TTCTCTTTGT AAAGGAGAGT AGGACTTGCC CTATTTTAAT TTTTTAATTT 1901 TTTTTAAAAT TTTTATTTTA ATTTATTAAT TATTTAGATT GTTTTAATTT 1951 TAAAATTTTC TATGGAACGC TTTAATAATT AGTTAACAAA TTACTATGCT 2001 ACTAATGAAT ATAAATTAAG GATAATTTTT AATTATATAG GATTATTAAA 2051 ATAAAAATCT ATATACAAGA ATAATCTTAA ATA The senquence was assembled from the following unassembled shotgun reads found in the L. (V.) braziliensis database ( >brazil20h04.q1k >brazil27a07.q1k >brazil81e11.p1k >brazil802h07.q1k 259

260 13.4. ANEXO 4. POSTER: Evento: XIV Congreso Colombiano de Parasitología y Medicina Tropical Determinación de las regiones 5 y 3 no traducidas de los genes alfa tubulina de Lesihmania braziliensis 260

261

262 13.5. ANEXO 5. POSTER: Primer Congreso Colombiano de Biología Computacional. Diseño racional de péptidos sintéticos de la -tubulina de L. (V.) braziliensis 262

263

264 13.6. ANEXO 6. POSTER: XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL Clonación, expresión y obtención de anticuerpos contra la a-tubulina de Leishmania braziliensis 264

265

266 13.7. ANEXO 7. POSTER: I Jornada de Investigaciones Grupo de Enfermedades Infecciosas, Facultad de Ciencias PUJB Identificación de proteínas que se unen a las regiones UTR de los genes HSP70 de Leishmania braziliensis 266

267

268 13.8. ANEXO 8. RESUMEN: XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL Pull down como estrategia para el aislamiento de factores proteicos que interactúan con regiones no traducidas de ARN mensajero. 268

269 XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL Formato para envío de resúmenes de trabajos libres Fecha límite para recepción de resúmenes: 31 de julio de 2011 Por favor, lea cuidadosamente las instrucciones antes de escribir su resumen en el espacio provisto. Indique el tema en el que desea que se incluya su trabajo: Biología básica y molecular de patógenos Biología y control de vectores Casos clínicos en Medicina Tropical Ciencias sociales y salud Conflicto, desplazamiento y enfermedades tropicales Dengue y dengue hemorrágico Diagnóstico Entomología y control de vectores Epidemiología molecular Epidemiología, vigilancia y control de enfermedades tropicales Interacción huésped-patógeno Malaria Medio ambiente y salud Micobacterias Micología médica Microbiología médica Modelos animales Parasitismo intestinal Parasitismo tisular Parasitología básica y molecular Patogénesis de enfermedades infecciosas Resistencia microbiana (bacteriana, fúngica, parasitaria o viral) Sistemas de salud y atención de enfermedades tropicales Sistemas de información geográfica en estudio y control de enfermedades tropicales Virología médica Otro (especifique) Título del Trabajo Pull down como estrategia para el aislamiento de factores proteicos que interactúan con regiones no traducidas de ARN mensajero. Cesar Ramírez 1, José María Requena 2, Concepción J Puerta 1 1 Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá, Colombia 2 Centro de Biología Molecular Severo Ochoa, Consejo Superior de Investigaciones Científicas, Madrid, España. Introducción La regulación postranscripcional de la expresión génica en tripanosomatidos se manifiesta en puntos como la maduración, localización y estabilización de los transcritos, así como la eficiencia de la traducción. Cada uno de estos eventos está gobernado por la interacción entre motivos (cis-acting elements) sobre regiones no traducidas del ARN (5 UTR y 3 UTR) y factores proteicos (trans-acting elements). Para facilitar la identificación de estos elementos, se han desarrollado ensayos de unión ARN/proteína así, en el Laboratorio de Parasitología Molecular de la Pontificia Universidad Javeriana se identificaron proteínas de unión a las regiones 5 y 3 UTR de los genes HSP70 de L. braziliensis. Materiales y métodos El ARN de las regiones 5 y 3 UTR, obtenido por transcripción in vitro, fue unido a microperlas, la cuales se enfrentaron al lisado citoplasmático total del parasito, que además contenia cocktel inhibidor de proteasas, inibidor de ARNasas y ARN competidor. La elución de la proteína específica se hizo en buffer de rehidratación y fue resuelta mediante electroforesis en 2 dimensiones. El análisis se hizo mediante el software ImageMaster 2D Platinum 6.0. Los puntos fueron identificados por MALDI TOF/TOF. Resultados Entre las proteínas de unión identificadas están la RPA1 LbrM , específicamente unida a la región 3 UTR-II de los genes HSP70 de L. braziliensis y la proteína mitocondrial de unión a ARN LbrM conocida como Rpb38p también unida a la 3 UTR-I de los genes HSP70 y 3 UTR de los genes -tubulina. Conclusión La técnica Pull Down es útil para elucidar de manera preliminar interacciones existentes entre secuencias específicas de ARN y proteínas, hecho relevante en el entendimiento de los mecanismos de regulación postrascripcional, sin embargo los hallazgos, deben ser validados in vivo.

270 Tipo preferido de presentación: Oral (10 minutos) Cartel Oral Certifico que he leído las condiciones para la presentación de trabajos libres y que el trabajo cuyo resumen envío las cumple x (por favor, marque con una X). Fecha: Julio 18 de 2011 Expositor Apellidos: Ramírez Nombre : Cesar Institución: Pontificia Universidad Javeriana Dirección: Carrera 7 No , Ed. 50. Laboratorio 113 Ciudad: Bogotá, DC Departamento : Cundinamarca Teléfono: , ext Fax: ext 4021 Dirección de correo electrónico: cramirezbiologo@gmail.com Diligencie el formato, guárdelo y envíelo como archivo anexo a: xxcongresoflap2011@uniandes.edu.co

271 13.9. ANEXO 9. RESUMEN: XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL Genes HSP70 de Leishmania braziliensis, un modelo para el estudio de regulación post-transcripcional 271

272 XX CONGRESO LATINOAMERICANO DE PARASITOLOGÍA Y XV CONGRESO COLOMBIANO DE PARASITOLOGÍA Y MEDICINA TROPICAL Formato para envío de resúmenes de conferencias Fecha límite para recepción de resúmenes: 15 de junio de 2011 Por favor, lea cuidadosamente las instrucciones antes de escribir su resumen en el espacio provisto. Genes HSP70 de Leishmania braziliensis, un modelo para el estudio de regulación posttranscripcional Cesar Ramírez 1, Jose María Requena 2, Concepción J. Puerta 1 1. Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontifica Universidad Javeriana, Bogotá, Colombia 2. Centro de Biología Molecular Severo Ochoa, Consejo Superior de Investigaciones Científicas, Madrid, España Los tripanosomátidos, incluyendo las leishmanias, constituyen un modelo biológico muy interesante de regulación de la expresión génica. En estos organismos, los genes independientemente de su función, se organizan están arreglados en unidades de transcripción policistrónica independientemente de su función, a diferencia de las bacterias, el ARNm antes de ser traducido, requiere ser procesado a monocistrón, evento que ocurre a través de la adición de una secuencia líder o mini-exón en el extremo 5 y de la cola de poliadeninas en el extremo 3. En consecuencia, la regulación génica en estos parásitos opera básicamente a nivel post-transcripcional e involucra el procesamiento, transporte, localización y estabilidad del ARNm, así como la eficiencia de la traducción, las modificaciones post-traduccionales y la vida media de las proteínas. Distintos estudios han evidenciado que parte de las funciones antes mencionadas se llevan a cabo gracias a la interacción entre las proteínas de unión al ARNm y las regiones no traducidas (UTR) de éstos, especialmente la 3 UTR, en donde se localizan la mayoría de las secuencias o motivos de reconocimiento; siendo en esta era post-genómica de gran importancia la identificación tanto de las proteínas como de las secuencias blancos con las cuales interactúan (1). Por otra parte, las proteínas de choque térmico (HSP) y entre ellas las de la familia de 70 kda (HSP70), se encuentran comprometidas en un conjunto de procesos celulares necesarios para el funcionamiento normal de la célula y la respuesta al estrés ocasionado por choque térmico, entre otros (2). En tripanosomátidos el estrés térmico sucede al pasar del insecto vector (22-28 C) al hospedero mamífero (35-37 C). De hecho estudios de proteómica reportan que la transición de promastigote a amastigote se acompaña de un incremento de la HSP70 citoplasmática (3). Aún cuando no es claro si estas proteínas intervienen directamente en el proceso de diferenciación, las HSP70 son de vital importancia para el establecimiento de la infección y desarrollo del parásito en el nuevo ambiente celular. Adicionalmente, la HSP70, particularmente en Leishmania, tiene un efecto anti-apoptótico que protege al parásito frente al tratamiento con antimoniales (4). En Leishmania los genes codificantes para las HSP70 típicas citoplasmáticas (HSP70A) han sido caracterizados en varias especies, encontrándose que en la mayoría estos genes se codifican por dos tipos de unidad. Así, el genoma de Leishmania infantum contiene 6 genes HSP70 de 3,8 kb organizados en tándem cabeza-cola, los cuales se localizan en un único locus (5). Estos genes son altamente conservados en su secuencia con excepción de la región 3 UTR del sexto gen localizado en el extremo 3 del tándem. Para mayor claridad, los primeros cinco genes del tándem han sido denominados HSP70-I y el sexto HSP70-II. Notablemente, se conoce que mientras los transcritos HSP70-I se acumulan en respuesta al estrés térmico y se traducen tanto a 26 como a 37 C, los ARNm derivados de los genes HSP70-II no se acumulan bajo tratamiento térmico, pero se traducen preferencialmente a 37 C (6). Llamativamente, mutantes del parásito carentes del gen HSP70-II, presentan alteraciones en su fenotipo, crecimiento y virulencia (7). A diferencia de las especies hasta ahora estudiadas del subgénero Leishmania, en Leishmania Viannia braziliensis tan solo se ha reportado la presencia del gen HSP70-I. Es así como análisis de "Southern blot" usando la región 3 UTR de los genes HSP70-II de L. infantum como sonda,

273 sugieren la ausencia de estos genes en este parásito. Sin embargo, ensayos de "Northern blot" usando la región codificante de los genes HSP70 como sonda evidencian la presencia de dos transcritos diferentes de tamaños similares. Resultados que sugieren que la región 3 UTR de los genes HSP70-II es bastante divergente de la región respetiva de las demás especies de Leishmania reportadas (8). Teniendo en cuenta lo anterior, en este trabajo se estudió la organización genómica y transcripción de los genes HSP70A de L. braziliensis; así como la determinación de sus regiones 5 y 3 UTR. En primer lugar, los resultados de los análisis de Southern blot de ADN genómico digerido parcial o totalmente con diversas endonucleasas e hibridado con la región intercodificante de los genes HSP70 (IR-HSP70) del parásito, evidenciaron la existencia de al menos siete genes HSP70A organizados en tándem cabeza-cola. Hallazgo que complementa la información anotada en el proyecto genoma, en donde se observa la presencia en la hebra antisentido del cromosoma 28, de un gen HSP70 completo (GeneDB ID: LbrM28_v2.2990) y dos secuencias parciales, LbrM28_v (codificante para la región amino terminal) y LbrM28_v (codificante para la región C-terminal), separadas por un gap de longitud desconocida. Así mismo, los resultados de separación de los cromosomas mediante electroforesis en campo pulsado seguido de transferencia e hibridación con la sonda IR-HSP70, concuerdan con su ubicación en un cromosoma de 1,5 Mb. Tras ensayos de RT-PCR usando un oligo d(t) para la síntesis del ADNc, seguido de amplificación con cebadores correspondientes a las secuencias del gen mini-exón y a una secuencia corriente abajo del ATG de inicio del gen HSP70 para obtener la región 5 UTR y los cebadores correspondientes a una región corriente arriba del codón de parada del gen HSP70 y el oligo d(t) para el caso de la región 3 UTR, las secuencias UTR de los genes HSP70A de L. braziliensis fueron determinadas. De especial interés, se encontraron dos clases de regiones 3 UTR, correspondientes a los genes HSP70-I y II, en donde la 3 UTR-I de 936 pb corresponde a la entrada LbrM28_v y la 3 UTR-II de 932 pb, a la entrada LbrM28_v Ensayos de Southern blot utilizando la región 3 UTR-II como sonda, sugieren la presencia de un solo gen HSP70-II, precedido por 6 copias de los genes HSP70-I. Organización similar a la reportada en las otras especies de Leishmanias tanto en el número como en el orden de los genes. Esta estricta conservación de la organización genómica en ambos subgéneros del parásito presupone un papel o impacto funcional de la misma. Por otra parte, la comparación de las secuencias de las regiones UTR de L. braziliensis con las reportadas en los proyectos genomas permitieron deducir dichas regiones en L. major y L. infantum encontrando al comparar la identidad de nucleótidos entre estas que mientras las regiones 5 UTR y 3 UTR-I de L. braziliensis tienen identidades de 71 a 81% con su contraparte en L. major y L. infantum, la región 3 UTR-II tan solo conserva un 55 a 57 % de identidad, presentando algunas secuencias exclusivas de especie y careciendo de algunas secuencias comunes a las otras especies. Al realizar los ensayos de Northern blot utilizando la sonda IR- HSP70, se observó la presencia de dos fragmentos de hibridación de tamaño similar. El uso de sondas específicas para las regiones 3 UTR I y II permitió elucidar que los transcritos de mayor tamaño corresponden al ARNm del gen HSP70-II y los de menor a los de los genes HSP70-I. De especial interés, ninguno de los transcritos mostró acumulación dependiente de la temperatura. Sin embargo, las diferencias encontradas de secuencia y contenido de GC entre las regiones 3 UTR I y II sugieren que la expresión de estos transcritos se regula de forma diferencial. Así, como una primera aproximación al estudio de los factores proteicos que pudieran estar actuando en trans con las regiones UTR de los genes HSP70A de L. braziliensis, se realizaron ensayos de Pulldown usando como cebo las regiones UTR de los genes HSP70 unidas a perlas magnéticas en presencia de extractos proteicos del parásito (obtenidos en condiciones normales y de choque térmico) con posterior identificación mediante análisis de electroforesis en dos dimensiones y MALDI TOF/TOF, usando las regiones UTR de los genes codificantes para la -tubulina como control no relevante y perlas sin ARN cómo control negativo. Tras los análisis efectuados se identificaron las proteínas Subunidad 1 del factor de replicación A (Rpa1) y Glicerol 3 fosfato deshidrogenasa (G3PDH), como de interacción exclusiva con la región 3 UTR-II de los genes HSP70 de Leishmania braziliensis y la -tubulina como de interacción exclusiva con la 5 UTR de estos mismos genes del parásito. Asociada a la 3 UTR-II de la HSP70 a 26 C y a la 3 UTR de la -tubulina a ambas temperaturas, se identificó la hexoquinasa. Finalmente, asociada a ambas regiones 3 UTR de la HSP70 (todas las temperaturas) y la -tubulina (solo a 26 C), se encontró la

274 proteína Rpb38 (Tc38). Referencias 1. Requena JM. Lights and shadows on gene organization and regulation of gene expression in Leishmania. Frontiers Bioscience 2011;16: Requena JM, Soto M, Quijada L, Alonso C. Antigenicidad e inmunogenicidad de las proteínas de choque térmico. Ars Pharmacia 1997;38: McNicoll F, Drummelsmith J, Müller M, Madore E, Boilard N, Ouellette M, et al. A combined proteomic and transcriptomic approach to the study of stage differentiation in Leishmania infantum. Proteomics 2006;6: Raina P, Kaur S. Chronic heat-shock treatment driven differentiation induces apoptosis in Leishmania donovani. Mol Cell Biochem. 2006;289: Quijada L, Soto M, Alonso C, Requena JM. Analysis of post-transcriptional regulation operating on transcription products of the tandemly linked Leishmania infantum hsp70 genes. J Biol Chem. 1997;272: Folgueira C, Quijada L, Soto M, Abanades DR, Alonso C, Requena JM. The translational efficiencies of the two Leishmania infantum HSP70 mrnas, differing in their 3 untranslated regions, are affected by shifts in the temperature of growth through different mechanisms. J Biol Chem. 2005;280: Folgueira C, Carrión J, Moreno J, Saugar JM, Cañavate C, Requena JM. Effects of the disruption of the HSP70-II gene on the growth, morphology, and virulence of Leishmania infantum promastigotes. Int Microbiol. 2008;11: Folgueira C, Cañavate C, Chicharro C, Requena JM. Genomic organization and expression of the HSP70 locus in New and Old World Leishmania species. Parasitology 2006;134:1-9. Fecha: Expositor Apellido: Puerta Nombre : Concepción J Institución: Pontificia Universidad Javeriana Dirección: Carrera 7 No 43-82, Edificio 52, Oficina 608 Ciudad: Bogotá País: Colombia Teléfono: ext. 4023, 4022 Fax: ext Dirección electrónica: cpuerta@javeriana.edu.co Diligencie el formato, guárdelo y envíelo como archivo anexo a: xxcongresoflap2011@uniandes.edu.co

275 ANEXO 10. RESUMEN: II Jornada de Investigaciones Grupo de Enfermedades Infecciosas, Facultad de Ciencias PUJB Descubrimiento de edición del ARNm en Leishmania braziliensis 275

276 II Jornada de Investigaciones Grupo de Enfermedades Infecciosas, Facultad de Ciencias PUJB Descubrimiento de edición del ARNm en Leishmania braziliensis Cesar Ramírez 1, José María Requena 2, Concepción J Puerta 1 1 Laboratorio de Parasitología Molecular, Departamento de Microbiología, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá, Colombia 2 Centro de Biología Molecular Severo Ochoa, Consejo Superior de Investigaciones Científicas, Madrid, España. Trabajo financiado por Colciencias, proyecto Código No Autor responsable de la presentación: cramirezbiologo@gmail.com Introducción La edición del ARNm en tripanosomátidos es un mecanismo post-transcripcional que mediante la inserción y eliminación de residuos de uridina en los pre-arnm mitocondriales crea transcritos funcionales. Proceso que aún no ha sido demostrado en especies patógenas de Leishmania del subgénero Viannia. Materiales y métodos En el proceso de clonación de las regiones 3 no traducidas de los genes HSP70 de L. braziliensis se aisló el clon 600D. Alineamientos con secuencias ensambladas y no ensambladas del genoma del parásito y análisis BLAST/N permitieron determinar su identidad. A partir de ensayos de RT- PCR usando cebadores que anillan en 600D, se clonaron, secuenciaron y analizaron los 4 productos obtenidos. Mediante Northern blot usando como sonda 600D, se corroboró la expresión de éstos. Resultados El clon 600D presentó homología en sus primeros 155 nucleótidos con una región del maxicírculo (genoma mitocondrial) de Leishmania donovani, sugiriendo la existencia de un transcrito mitocondrial editado. Usando la secuencia de 155 pb como sonda, se derivó a partir del genoma no ensamblado de L. braziliensis, la secuencia del pre-arnm respectivo, encontrando una perfecta alineación con 600D, con excepción de los residuos de uridinas. Análisis de los marcos de lectura indicaron que correspondía al gen ND8 parcialmente editado. Los clones obtenidos por RT-PCR correspondieron también a transcritos parcialmente editados. Los resultados de Northern blot confirmaron la existencia de estos transcritos parcialmente editados. Conclusión Se reporta por primera vez la ocurrencia de edición del ARNm en parásitos del subgénero Leishmania Viannia.

277 ANÁLISIS PRELIMINAR DE SECUENCIAS, ESTRUCTURAS 2D Y 3D DE PROTEÍNAS PREVIAMENTE CONOCIDAS COMO HIPOTÉTICAS La información que se muestra a continuación se obtuvo con la herramienta online Phyre 2 CODIGO DE COLORES DE LOS aa A,S,T,G,P pequeños/polares K,R,E,N,D,H,Q cargados M,I,L,V - hidrofóbicos W,Y,F,C - aromáticos + cisteína PLEGAMIENTOS? Desorden (%) Hélices alfa (%) Pliegues Beta ( %) Confidence Key Representa la probabilidad de que la estructura observada sea real Alta (9) Baja (0) DIAGRAMA DE ESTRUCTURA SECUNDARIA Se muestra de arriba hacia abajo: La posición de los aa cada 10. La secuencia de aa coloreada como se indicó para cada grupo de aa. La estructura secundaria según convenciones indicadas previamente. SS confidence hace referencia a la confianza de la predicción Disorder las regiones donde se predice desorden están indicadas con (?). INFORMACIÓN DE LAS MOLÉCULAS USADAS COMO MOLDE 277

278 De izquierda a derecha: Numero asignado a la secuencia Template la primera letra hace referencia a una cadena completa (c) o dominio (d), los siguientes 4 caracteres corresponden al número de acceso del PDB (ej. 2vv5) y la última letra refiere a la cadena identificada, si se observan números al final, sugieren diferentes posiciones en la cadena. Alignment Coverage muestra la posición en que se ubica la secuencia molde sobre la secuencia sometida. 3D Model muestra un modelo de la secuencia sometida construido a partir de la estructura molde respectiva. Confidence representa la probabilidad (de 0 a 100) de que la coincidencia entre la estructura sometida y la estructura molde corresponda a una verdadera homología, (valores >90% se consideran muy buenos). % i.d porcentaje de identidad entre la secuencia sometida y el molde, valores entre 30-40% se consideran muy buenos, sin embargo valores por encima del 15% también pueden ser útiles para hacer buenas predicciones. Template Information puede contener la función, el nombre de la molécula, la cadena y si hay un artículo referenciado, se muestra el título. 278

279 ESTRUCTURA SECUNDARIA DE LA PROTEÍNA LbrM

280 280

281 ESTRUCTURAS USADAS COMO MOLDE PARA MODELAR LA PROTEÍNA LbrM

282 MODELO 3D DE LA PROTEÍNA LbrM

283 ESTRUCTURA SECUNDARIA DE LA PROTEÍNA LbrM

284 284

285 ESTRUCTURAS USADAS COMO MOLDE PARA MODELAR LA PROTEÍNA LbrM

286 MODELO 3D DE LA PROTEÍNA LbrM

287 ESTRUCTURA SECUNDARIA DE LA PROTEÍNA LbrM

288 ESTRUCTURAS USADAS COMO MOLDE PARA MODELAR LA PROTEÍNA LbrM

289 MODELO TRANS-MEMBRANA DE LA PROTEÍNA LbrM MODELO 3D DE LA PROTEÍNA LbrM

290 ESTRUCTURA SECUNDARIA DE LA PROTEÍNA LbrM

291 ESTRUCTURAS USADAS COMO MOLDE PARA MODELAR LA PROTEÍNA LbrM

292 MODELO 3D DE LA PROTEÍNA LbrM

293 ESTRUCTURA SECUNDARIA DE LA PROTEÍNA LbrM

294 ESTRUCTURAS USADAS COMO MOLDE PARA MODELAR LA PROTEÍNA LbrM

295 MODELO 3D DE LA PROTEÍNA LbrM

296 ESTRUCTURA SECUNDARIA DE LA PROTEÍNA LbrM

297 ESTRUCTURAS USADAS COMO MOLDE PARA MODELAR LA PROTEÍNA LbrM

298 MODELO 3D DE LA PROTEÍNA LbrM