Trastornos por deterioro cognitivo. Verónica Marcos de la Iglesia QIR 3 ANÁLISIS CLÍNICOS

Save this PDF as:
 WORD  PNG  TXT  JPG

Tamaño: px
Comenzar la demostración a partir de la página:

Download "Trastornos por deterioro cognitivo. Verónica Marcos de la Iglesia QIR 3 ANÁLISIS CLÍNICOS"

Transcripción

1 Trastornos por deterioro cognitivo Verónica Marcos de la Iglesia QIR 3 ANÁLISIS CLÍNICOS

2 más de 80 causas diferentes Cerebro DEMENCIA Deterioro global, generalmente progresivo, de las funciones cognitivas superiores en un individuo que había adquirido previamente

3 Prevalencia media de demencia en diferentes estudios

4 Trastorno por deterioro cognitivo DSM IV Clasifica Delirium, demencia, trastorno amnésico y otros Trastornos mentales debidos a una enfermedad médica Trastorno por consumo de sustancias

5 DEMENCIA DEFINICIÓN: Alteración significativa de las funciones cognitivas o la memoria que representan un cambio del nivel previo de actividad.

6 DEMENCIA Un síndrome adquirido (puede deberse a múltiples causas) Predomina la alteración n cognitiva -memoria. -pensamiento abstracto -razonamiento. Conlleva a un deterioro progresivo del funcionamiento social y ocupacional del paciente

7 DEMENCIA Factores predisponentes: Edad, enf. Alzheimer, factor genético, hipertensión arterial, diabetes, obesidad, arritmias. Factores causales (Etiología): Corea de Huntington, enf. Alzheimer, Parkinson, Tumores cerebrales, anoxia, enf. Hepática, enf. Neurológica, trastornos inmunológicos, sifílis, defícit de vitamina B12.

8 Demencias degenerativas primarias CLASIFICACIÓN Demencias Vasculares Demencias Secundarias

9 Demencias degenerativas primarias Se desconoce la causa/afectación n encefálica primaria -Alzheimer : + frecuente (50%). -Demencia degenerativa lóbulo frontal -Enfermedad de Pick. -Parkinson. -Corea de Huntington. CARACTERISTICAS Afectación precoz de la memoria. * De inicio precoz : < 65 años. * De inicio tardío : > 65 años. Deterioro múltiple y progresivo de las funciones superiores. Aparición de síntomas psiquiátricos /conducta. Evolución progresiva hacia la pérdida de la independencia personal

10 Demencias Vasculares - Lesiones cerebrales causadas por alteraciones vasculares. - Su inicio se puede precisar con más exactitud. - Los síntomas dependen de la región afectada del encéfalo. Son provocadas por condiciones que disminuyen el aporte de sangre / oxígeno al tejido cerebral de forma más o menos permanente Tipos: -Corticales. -Subcorticales.

11 Demencias Secundarias Etiología a muy diversa Tratables El cuadro puede ser reversible Por infecciones -HIV. -Enf priónicas ( C.Jackob) Por hidrocefalia Metabólicas/endocrinas -Hipo/hiper tiroidismo. -Enf. Wilson CLASES Carenciales - Déficit de B12, ac. Fólico Traumáticas (TCE) Esclerosis múltiplem Por tóxicost - Alcohol, monóxido de carbono

12 Nivel de consciencia -Hepatopatía - Hipoxia Alterado Delirio - Tóxicos y drogas - Alt. suprarrenales -Alt. tiroideas -Infecciones -Fármacos -Etilismo -Privación o sobrecarga sensorial Defectos selectivos corticales (afasias, apraxias, agnosias) Normal Mini examen cognitivo Sin alt. memoria Esquizofrenia Olvidos benignos Pseudodemencia depresiva Con alt. memoria Demencia

13 ENFERMEDAD DE ALZHEMER (EA)

14 ENFERMEDAD DE ALZHEMER DEFINICIÓN: (EA) Enfermedad cerebral irreversible y progresiva que lentamente destruye la memoria y las habilidades intelectuales.

15 EA: Un poco de historia En una reunión de psiquiatras alemanes celebrada en Alois Alzheimer describió el caso de una mujer de 51 años con pérdida severa de memoria, desorientación, alteraciones de lenguaje e ideas paranoides, que murió cuatro años después en un estado de severa demencia. En su autopsia se encontraron lesiones cerebrales consistentes, con atrofia cerebral y presencia de cuerpos denominados seniles. Comenzaba en este momento una apasionante historia, la descripción y preocupación por una enfermedad que ha dado lugar a la mayor investigación sobre el funcionamiento del sistema nervioso humano, y que fue denominada con el nombre de su descubridor, la enfermedad de Alzheimer. Actualmente el diagnóstico de casos de demencia es diez veces superior al detectado a principios de siglo. Hasta hace pocos años se creía que la senilidad era la consecuencia natural e inevitable de la edad. Sin embargo, desde 1977 a través de diversos estudios realizados, se ha visto que el 10% de las personas mayores de 65 años sufren lesiones cerebrales orgánicas que se relacionan con la senilidad; de estas lesiones el 75% se diagnosticaron como la enfermedad de Alzheimer y el 25% restante se corresponde con alteraciones cerebrales producidas por infartos múltiples La persona que padece una enfermedad de Alzheimer se encuentra totalmente indefensa dependiendo de los medios familiares, sociales o médicos con los que cuenta la sociedad en que vive.

16 EA: EPIDEMIOLOGÍA Población general: 1-2% Mayores de 65 años: 5 10% Mayores de 80 años: % Duración: 6 a 30 años. Coste anual por familia:

17 EA: CARACTERÍSTICAS - Demencia más frecuente Pérdida de memoria con interferencia en actividades de vida diaria (anosognosia) - Alteraciones del lenguaje - Apraxia y déficits visuespaciales - Pérdida de juicio y capacidad de razonamiento - Pérdida de inhibiciones y agresividad alternando con pasividad y retraimiento - Alteración patrón sueño-vigilia - Etapa final: rigidez, mutismo, incontinencia

18 EA: CARACTERÍSTICAS - Es un proceso neurodegenerativo. - Provoca deterioro de las habilidades cognitivas. - La evolución es individual para cada individuo. - Cuando aparecen los síntomas: - Ya hay pérdida del 80% de las neuronas en esa región. - No hay degeneración física del enfermo.

19 EA: CARACTERÍSTICAS Estadística vital del cerebro: Peso en el adulto: kg. Tamaño en adulto: coliflor. Número de neuronas: millones. Número de sinapsis: (100 trillones).

20 EA: Áreas comprometidas - Conecta la médula espinal con el cerebro. Los tres principales protagonistas Hemisferios cerebrales Cerebelo -Recibe -Se encarga y procesa del equilibrio la información y balance del corporal. mundo exterior -Controla -Recibe la los información movimientos Tallo de cerebral los voluntarios. ojos, oídos, músculos y -Regula articulaciones el pensamiento acerca de consciente los movimientos y al actividad y posición mental. del cuerpo.

21 EA: FISIOPATOLOGÍA En el cerebro de las personas con EA encontramos: 1. Abundancia de dos estructuras normales: - B amiloide - Ovillos neurofibrilares 2. Alteración de una proteína: - Proteína Tau.

22 Beta-amiloide y ovillos neurofibrilares Normal B-amiloide

23 Beta-amiloide y ovillos neurofibrilares

24 Beta-amiloide - Son depósitos densos de proteínas material celular. - Se depositan formando placas. - Se acumulan en el espacio intersticial rodeando a células y nervios.

25 Beta-amiloide Con la edad se expresan las llamadas Proteínas Precursoras de Amiloideas (APP). Enzimas rompen la APP en fragmentos incluyendo el B- amiloide. Las moléculas APP atraviesan la membrana de la neurona. Fragmentos el B-amiloide se acumulan en forma de palcas.

26 Ovillos Neurofibrilares - Son fibras enrolladas sobres si mismas. - Se acumulan dentro de la neurona. - Bloquean las funciones nerviosas.

27 EA: FISIOPATOLOGÍA En el cerebro de las personas con EA encontramos: 1. Abundancia de dos estructuras normales: - B amiloide - Ovillos neurofibrilares 2. Alteración de una proteína: - Proteína Tau.

28 Proteína Tau -Estabilización de los microtúbulos. -Regula el equilibrio de las interacciones entre células nerviosas. -En Alzheimer, tau experimenta cambios que provocan que se acumule anormalmente en filamentos enredados en las neuronas -Los agregados de esta proteína asociados a los microtúbulos con varios grupos de fosfato son una característica determinante de los trastornos neurodegenerativos, conocidos como taupatías.

29 El efecto tóxico se produce fundamentalmente por la liberación de radicales libres en la unión con determinados receptores. El aumento de homocisteína está relacionado con un mayor riesgo de EA. RADICALES LIBRES Daño oxidativo Daño neuronal Enf.de Alzheimer

30 Las neuronas saludables deben: - Comunicarse entre ellas. - Realizar su metabolismo. - Ser capaces de repararse. Las alteraciones se inician en su interior. Se acumulan sustancias tóxicas: radicales libres. Sus tres principales funciones ya no se cumplen. La EA se podría explicar por la acumulación de radicales libres.

31 EA: Clasificación - EA Genética (1 a 5 % de los casos) - EA Esporádica (factores ambientales) Son fenotípicamente indistinguibles.

32 EA: Clasificación Inicio precoz (<65 años) (3-5%) Familiar (1 familiar de primer grado) Esporádica Inicio tardío (>65 años) (95-97%) Familiar (3 familiares de 1er grado en dos generaciones) Esporádica

33 EA: Genética - Edad de inicio: años. - Etiología: mutaciones en tres genes: - APP: Gen precursor de la proteína B-amiloide. - PSEN 1: Presenilina 1. - PSEN 2: Presenilina 2. - Existen otros genes que también se encuentran mutados en la EA. Destaca el gen APO E: tardía o esporádica

34 Proteína APP Péptido señal Dominio cisteínas Inhibidor de proteasas Dominio transmembrana N C Dominio Citoplásmico Péptido amiloide KM DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT VIVITLVML

35 Funciones de la proteína APP - Regulación de proteasas - Reparación tisular cerebral - Promoción de adhesión celular - Receptor de la kinesina - Transducción de señales

36 Generación de péptidos B-amiloide Dominio extracelular Dominio transmembrana KMDAEFRHDSGYEVHHQKLVFFAEDVGSNK GAIIGLMVGGVVIATVIVITLVML KKKQY A 40 Secretasa A 42 Secretasa

37 Mutaciones en la proteína APP Péptido señal Dominio cisteínas Inhibidor de proteasas Dominio transmembrana N C Dominio Citoplásmico Péptido amiloide KM DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT VIVITLVML VF NL GQ I G

38 Presenilina Mutaciones de Presinilina 1

39 Presenilina Presenilin 1 (PS1) Autosómica dominante Penetrancia completa Cromosoma % de Alzheimer familiar Comienzo en los 40s Presenilin 2 (PS2) Autosómica dominante Penetrancia incompleta Cromosoma 1 Pocas familias ~1% Alzheimer familiar (sobre todo germanos del Volga) Comienzo variable (40-80s)

40 Mutación Efecto en APP Efecto en Aβ S. Down Más cantidad de proteína Más Aβ42 y Aβ40 APP670 Potencia β-secretasa Más Aβ42 y Aβ40 APP716 Altera corte de γ-secretasa Más Aβ42 APP717 Altera corte de γ -secretasa Más Aβ42 PS-1 Altera procesamiento Más Aβ42 PS-2 Altera procesamiento Más Aβ42

41 Genes Mutados en enfermedad de Alzheimer de inicio precoz familiar Cromosoma 21 Cromosoma 14 Cromosoma 1 APP (27 mutaciones) PSN1 (157 mutaciones) PSN2 (10 mutaciones)

42 Genes Asociados con enfermedad de Alzheimer de inicio tardío Cromosoma 14 PSN1 Cromosoma 19 APO E Cromosoma 7 IL-1 Cromosoma 1 MTHRF

43 Asociación Alélica APO E - Localización: 19q Cuatro exones y tres intrones, con un total de 3597 pares de bases. - El gen es pleomórfico, con tres alelos principales, ApoE2, ApoE3 y ApoE4, que traducen tres isoformas de la proteína: - E2 se asocia con hiperlipoproteinemia tipo III, así como con un aumento o una disminución del riesgo de ateroesclerosis. - E4 está implicada con ateroesclerosis, EA y desarrollo cognitivo inadecuado

44 Codon 112 Codon 158 E CYS CTGC CYS CTGC E3 CYS ARG CTGC CCGC E4 ARG ARG CCGC CCGC

45 Genotipo Riesgo ApoE 4,4 (x9) Edad temprana ApoE 3,4 (x3) ApoE 3,3 ApoE 2,4 Normal ApoE 2,3 Protector En la mayoría de los pacientes con mutación en el gen APOE, el alelo ε4 disminuye la edad de inicio mientras que el ε2 la aumenta, sin embargo mutaciones en las presinilinas no parecen influir en la edad de aparción de EA.

46 Temprano Alzheimer (20 años) Etapas tempranas o moderadas de EA (2-10 años) Etapa severa o tardía (1-5años)

47 Presenilina Gen APOE Enfermedad de Alzheimer

48 Marcadores Bioquímicos LCR Se asocian a DTA o a DCL con progresión a DTA: Proteína Tau Total (T ) Proteína Tau hiperfosforilada (P )(varios epítotos) A 42 Proteína Tau + A 42 Isoprostano Neprelisina

49 Marcadores Bioquímicos LCR Tau Proteína Tau Total (T ) [ELISA] No específica. Elevada en otras enfermedades neurodegenerativas e ictus agudo. Discrimina bien EA de individuos normales u otras causas de deterioro sin daño neuronal-axonal (depresión, alcoholismo, E Park). E: 90%; S: 80% Proteína Tau hiperfosforilada (P ) [ELISA] Treonina 231; Más específica que la Tau para la EA La P normal en otras causas de demencias y en otras NeuroDeg (DFT, DCLewy). E: 92%; S: 80%

50 Marcadores Bioquímicos LCR A A 42 [innogenetics ELISA] la A 40 menos estudiada Diferencia bien EA de Normalidad, Depresión, E. Park y PSP Diferencia mal EA de DCLewy, DFT E: 90%; S: 85% (para diferenciar DCL-DTA de Normalidad) Proteina Tau + A 42 Mayor especificidad

51 Marcadores Bioquímicos LCR: Otros Isoprostano (en EA inicial y DCL) Producto de la peroxidación lipídica No hay estudios longitudinales Neprelisina Endopeptidasa neuronal implicada en el catabolismo de la A. Otros: Interleukina 6 Agentes proinflamatorios Moléculas promotoras de stress oxidativo BDNF (Brain Derivatives Neurotrophic Factor) Proteínas implicadas en la plasticidad sináptica (sinapsinas)

52 Marcadores Bioquímicos LCR: Progresión de DCL a DTA El de Tau en LCR en pacientes con DCL predice con E 90% y S 100% la transición a EA. Tau + 42 en 90% de DCL Progresores y 10% de DCL estables

53 Marcadores Bioquímicos LCR: Conclusiones Los niveles de P-Tau y AB42: Baja especificidd para diferenciar tipos de Demencia Deben interpretarse en el seno de otra información disponible del paciente (en el sentido de información acumulativa )

54 MUCHAS GRACIAS!!!

EL ALZHEIMER. 2. Tipos: Existen dos tipos de enfermedad de Alzheimer (EA): la familiar y la espodárica.

EL ALZHEIMER. 2. Tipos: Existen dos tipos de enfermedad de Alzheimer (EA): la familiar y la espodárica. EL ALZHEIMER 1. Definición: La enfermedad de Alzheimer (EA) es un proceso neurodegenerativo progresivo, en el que la persona afectada pierde la memoria reciente y las facultades intelectuales, presentando

Más detalles

Demencias. Juan Jiménez Alonso Patología Médica II Curso 2005-2006

Demencias. Juan Jiménez Alonso Patología Médica II Curso 2005-2006 Demencias Juan Jiménez Alonso Patología Médica II Curso 2005-2006 Funciones intelectuales Memoria (episódica, remota) Lenguaje Habilidades visuales-espaciales Personalidad Cognitivas (abstracción, cálculo,

Más detalles

Enfermedad de Alzheimer

Enfermedad de Alzheimer Enfermedad de Alzheimer Alois Alzheimer en 1906 la describió con placas seniles, ovillos neurofibrilares y cambios arterioescleróticos cerebrales. La denominación del cuadro clínico como enfermedad de

Más detalles

CONOCIENDO LA ENFERMEDAD DE ALZHEIMER

CONOCIENDO LA ENFERMEDAD DE ALZHEIMER II ESCUELA DE FAMILIAS 9 de marzo de 2010 CONOCIENDO LA ENFERMEDAD DE ALZHEIMER Dr. Javier Gay Puente Neurólogo CRE Alzheimer 9 de marzo de 2010 Qué es la enfermedad de Alzheimer? Descrita por Alois Alzheimer

Más detalles

SÍNDROMES DEMENCIALES. M. en C. Dr. Enrique de Font Réaulx R Neurocirujano

SÍNDROMES DEMENCIALES. M. en C. Dr. Enrique de Font Réaulx R Neurocirujano SÍNDROMES DEMENCIALES M. en C. Dr. Enrique de Font Réaulx R Neurocirujano Rita Levi, Premio Nobel de Medicina 1986 Tipos de Demencias Trastornos Cognitivos y del comportamiento Agudos Enfermedad de Alzheimer

Más detalles

DEMENCIAS. Universidad Intercontinental Área de la Salud Facultad de Psicología

DEMENCIAS. Universidad Intercontinental Área de la Salud Facultad de Psicología DEMENCIAS Universidad Intercontinental Área de la Salud Facultad de Psicología DEMENCIAS Lo que es Lo que no es Deterioro global de las funciones cognitivas Algunas demencias cursan con trastornos psiquiátricos

Más detalles

DEMENCIAS. Dra. Mª Isabel Galvá Borrás

DEMENCIAS. Dra. Mª Isabel Galvá Borrás DEMENCIAS Dra. Mª Isabel Galvá Borrás DEFINICIÓN DE DEMENCIA Síndrome adquirido que se caracteriza por un conjunto de signos y síntomas que producen un deterioro persistente de las funciones cognitivas

Más detalles

Demencia. Diagnóstico. Clasificación. Etapas. Tratamiento

Demencia. Diagnóstico. Clasificación. Etapas. Tratamiento ESCUELA DE CUIDADORES Demencia. Diagnóstico. Clasificación. Etapas. Tratamiento Dra. Liliam Rodríguez Rivera MEMORIA: Es la capacidad mental que posibilita a un sujeto registrar, conservar y evocar las

Más detalles

SOLICITUD DE ANÁLISIS GENÉTICO MOLECULAR DE DEMENCIAS DEGENERATIVAS. Marque con una X el estudio solicitado. - Estudio Molecular:...

SOLICITUD DE ANÁLISIS GENÉTICO MOLECULAR DE DEMENCIAS DEGENERATIVAS. Marque con una X el estudio solicitado. - Estudio Molecular:... CDGM Centro de Diagnóstico Genético Molecular de Enfermedades Hereditarias SOLICITUD DE ANÁLISIS GENÉTICO MOLECULAR DE DEMENCIAS DEGENERATIVAS Marque con una X el estudio solicitado 1. GENES IMPLICADOS

Más detalles

El caso de la proteína Tau

El caso de la proteína Tau Grupo de Microtúbulos (CBM-UAM) El caso de la proteína Tau El desarrollo de ratones transgénicos podría ser clave para resolver el enigma de la enfermedad de Alzheimer y el diseño de nuevos fármacos La

Más detalles

Enfermedades asociadas al sistema nervioso

Enfermedades asociadas al sistema nervioso Enfermedades asociadas al sistema nervioso La esclerosis múltiple es una enfermedad que afecta al sistema nervioso central; es debida a la pérdida de la vaina de mielina que rodea de manera discontinua

Más detalles

El caso de la proteína Tau 1 Xavier Pujol Gebellè

El caso de la proteína Tau 1 Xavier Pujol Gebellè El caso de la proteína Tau 1 Xavier Pujol Gebellè Alcmeon, Revista Argentina de Clínica Neuropsiquiátrica, Año 16, Vol. 14, Nº 1, septiembre de 2007, págs. 81 a 85. El desarrollo de ratones transgénicos

Más detalles

ENFERMEDAD DE ALZHEIMER

ENFERMEDAD DE ALZHEIMER ENFERMEDAD DE ALZHEIMER Bases para su diagnóstico QUÉ ES LA ENFERMEDAD DE ALZHEIMER? La enfermedad de Alzheimer es una forma de demencia. DEMENCIA Síndrome clínico ( síntomas y signos indicativos de deterioro

Más detalles

7. Estudio genético en demencias

7. Estudio genético en demencias 7. genético en demencias Preguntas para responder: 7.1. Cuándo está indicado realizar análisis genéticos para identificar mutaciones patogénicas en pacientes con demencia? 7.2. Cuándo está indicado realizar

Más detalles

Seminario de Verano 2012

Seminario de Verano 2012 Seminario de Verano 2012 Demencias en el joven (por debajo de los 40 años) La Demencia es rara antes de los 40 años. Suele presentarse: Como consecuencia de factores genéticos o enfermedades metabólicas

Más detalles

LA ENFERMEDAD DEL ALZHEIMER

LA ENFERMEDAD DEL ALZHEIMER LA ENFERMEDAD DEL ALZHEIMER Docente: Mg. Ana Grandez Vento 2014 EL ALZHEIMER Antes de iniciar el tema sobre la Enfermedad netamente del Alzheimer, aclaremos dudas sobre La demencia que es una de las principales

Más detalles

ASPECTOS GENERALES DEL ENVEJECIMIENTO. Manuel Nevado

ASPECTOS GENERALES DEL ENVEJECIMIENTO. Manuel Nevado ASPECTOS GENERALES DEL ENVEJECIMIENTO Manuel Nevado Muchas personas no cumplen los ochenta porque intentan durante demasiado tiempo quedarse en los cuarenta. Salvador Dalí (1904-1989). Pintor y escultor

Más detalles

Anexo 2. Información para pacientes

Anexo 2. Información para pacientes Anexo 2. Información para pacientes Qué es la demencia? La Organización Mundial de la Salud define la demencia como un síndrome debido a una enfermedad del cerebro, generalmente de naturaleza crónica o

Más detalles

Dr. Francisco Bravo Alva

Dr. Francisco Bravo Alva Dr. Francisco Bravo Alva Mayor de 65 años pertenece a la 3era edad. El adulto mayor pasa por la última etapa de la vida, ya consumaron su proyectos de vida y dejan de trabajar. Dejan también de realizar

Más detalles

La Enfermedad de Alzheimer

La Enfermedad de Alzheimer La Enfermedad de Alzheimer La enfermedad de Alzheimer fue descubierta a principios de siglo por el Doctor Alois Alzheimer, que analizó el cerebro de una paciente de 51 años, encontrando una atrofia general

Más detalles

ALZHÉIMER. La epidemia del siglo XXI

ALZHÉIMER. La epidemia del siglo XXI ALZHÉIMER La epidemia del siglo XXI QUÉ ES EL ALZHÉIMER? La enfermedad de Alzheimer (EA), también llamada demencia senil de tipo Alzheimer o alzhéimer es una enfermedad neurodegenerativa. Se caracteriza

Más detalles

Dossier de Prensa VACUNA EB 101

Dossier de Prensa VACUNA EB 101 Dossier de Prensa VACUNA EB 101 ÍNDICE 1 La enfermedad de Alzheimer Sabias que Qué es la enfermedad de Alzheimer? Epidemiología Causas Riesgos Asociados a la enfermedad de Alzheimer (EA) Costes Tratamiento

Más detalles

Alzheimer. Dr Nolasc Acarín n Tusell. www.acarin.es

Alzheimer. Dr Nolasc Acarín n Tusell. www.acarin.es Alzheimer Dr Nolasc Acarín n Tusell www.acarin.es 100.000 M de Neuronas Crecimiento por engorde, sinapsis, dendritas. Regeneración n???. Plasticidad por estimulación. Axones dirigidos por los genes.

Más detalles

Accidente Cerebrovascular (ACV)

Accidente Cerebrovascular (ACV) Clase 16 Accidente Cerebrovascular (ACV) Un accidente cerebrovascular sucede cuando el flujo de sangre a una parte del cerebro se detiene. Algunas veces, se denomina "ataque cerebral" (derrame cerebral).

Más detalles

PREGUNTAS FRECUENTES 1.- MI MADRE TIENE ENFERMEDAD DE ALZHEIMER. LA HEREDARÉ YO?

PREGUNTAS FRECUENTES 1.- MI MADRE TIENE ENFERMEDAD DE ALZHEIMER. LA HEREDARÉ YO? PREGUNTAS FRECUENTES 1.- MI MADRE TIENE ENFERMEDAD DE ALZHEIMER. LA HEREDARÉ YO? Hay muy pocos casos en los que la Enfermedad de Alzheimer tiene una herencia penetrante. En estos casos hay una relación

Más detalles

"Prevención del Alzheimer y del Ataque Cerebral: tienen algo en común?"

Prevención del Alzheimer y del Ataque Cerebral: tienen algo en común? "Prevención del Alzheimer y del Ataque Cerebral: tienen algo en común?" Ignacio J. Previgliano Prof. Asoc. de Medicina Interna Universidad Maimónides Director Curso Superior de Especialista en Terapia

Más detalles

2. Definición y clasificación de las demencias

2. Definición y clasificación de las demencias 2. Definición y clasificación de las demencias Preguntas para responder: 2.1. Qué es la demencia? 2.2. Cuál es la incidencia y prevalencia de la demencia? 2.3. Cómo se clasifica la demencia? 2.4. Cuáles

Más detalles

Además de la actividad antioxidante el ozono estimula los mecanismos de transporte y utilización del oxígeno a nivel celular.

Además de la actividad antioxidante el ozono estimula los mecanismos de transporte y utilización del oxígeno a nivel celular. En la enfermedad de Alzheimer como en prácticamente todas las enfermedades degenerativas se postulan diversas etiopatogénias, como son los factores ambientales y genéticos, además parece existir mayor

Más detalles

NUESTRA SEÑORA DEL CAMINO

NUESTRA SEÑORA DEL CAMINO NUESTRA SEÑORA DEL CAMINO Somos una Fundación prestadora de servicios integrales e innovadores de la más alta calidad dirigidos a familias con integrantes de la tercera edad que requieran cuidados especiales

Más detalles

La enfermedad La enfermedad es una alteración de las estructuras y de las funciones vitales de los seres vivos.

La enfermedad La enfermedad es una alteración de las estructuras y de las funciones vitales de los seres vivos. La enfermedad La enfermedad es una alteración de las estructuras y de las funciones vitales de los seres vivos. *Causas de una enfermedad. Las causas de enfermedad pueden no ser muy claras para algunas

Más detalles

COMUNICACIÓN CON EL ENFERMO DE ALZHEIMER. Felicidad Vicente

COMUNICACIÓN CON EL ENFERMO DE ALZHEIMER. Felicidad Vicente COMUNICACIÓN CON EL ENFERMO DE ALZHEIMER Felicidad Vicente DETERIORO COGNITIVO Y DEMENCIA Bajo rendimiento en algunos aspectos intelectuales, sobre todo memoria, a medida que se envejece. Muchas veces

Más detalles

Concepto Epidemiología Etiopatogenia Formas clínicas y manifestaciones Diagnóstico Tratamientos

Concepto Epidemiología Etiopatogenia Formas clínicas y manifestaciones Diagnóstico Tratamientos Demencias 1 Concepto Epidemiología Etiopatogenia Formas clínicas y manifestaciones Diagnóstico Tratamientos 2 Concepto Síndrome adquirido, de naturaleza biológica, que se caracteriza por un deterioro de

Más detalles

ALZHEIMER. Qué es el Alzheimer?

ALZHEIMER. Qué es el Alzheimer? ALZHEIMER Qué es el Alzheimer? El Alzheimer es una alteración neurodegenerativa primaria que suele aparecer a partir de los 65 años, aunque también puede presentarse entre personas más jóvenes. Se caracteriza

Más detalles

Los grandes síndromes psiquiátricos. Demencia y delirium

Los grandes síndromes psiquiátricos. Demencia y delirium Los grandes síndromes psiquiátricos Demencia y delirium Demencia: conceptos Definición (Lishman 1987): síndrome de deterioro global y adquirido de la inteligencia, la memoria y la personalidad, que ocurre

Más detalles

Diagnóstico de la enfermedad de Alzheimer y de demencia

Diagnóstico de la enfermedad de Alzheimer y de demencia Capítulo de Illinois Diagnóstico de la enfermedad de Alzheimer y de demencia El Alzheimer es diagnosticado a través de una evaluación médica exhaustiva. Si usted o un ser querido están preocupados por

Más detalles

COMUNICACIÓN CON EL ENFERMO DE ALZHEIMER. Felicidad Vicente

COMUNICACIÓN CON EL ENFERMO DE ALZHEIMER. Felicidad Vicente COMUNICACIÓN CON EL ENFERMO DE ALZHEIMER Felicidad Vicente QUÉ ES LA ENFERMEDAD DE ALZHEIMER? Es una enfermedad neurológica, Es una enfermedad neurológica, progresiva, irreversible y crónica, caracterizada

Más detalles

ENVEJECIMIENTO NATURAL O DEMENCIA PÉRDIDA DE FUNCIONES INTELECTUALES

ENVEJECIMIENTO NATURAL O DEMENCIA PÉRDIDA DE FUNCIONES INTELECTUALES ENVEJECIMIENTO NATURAL O DEMENCIA EN LAS PERSONES CON SD. PÉRDIDA DE FUNCIONES INTELECTUALES 1. Qué es la Enfermedad de Alzheimer? 2. Prevalencia de la Enfermedad de Alzheimer en pacientes con SD 3. Diagnóstico

Más detalles

Enfermedad de Pick. Causas

Enfermedad de Pick. Causas Enfermedad de Pick Fuente: Medline Plus Es una forma rara y permanente de demencia similar al mal de Alzheimer, excepto que tiende a afectar únicamente ciertas áreas del cerebro. Causas Las personas que

Más detalles

CEAFA - Confederación Española de Familiares de Enfermos de Alzheimer y otras demencias

CEAFA - Confederación Española de Familiares de Enfermos de Alzheimer y otras demencias Letra "A" Acetilcolina (Ach) Neurotransmisor imprescindible para que el cerebro funcione adecuadamente, especialmente los procesos de información - comunicación cerebral y cuya concentración se reduce

Más detalles

3. Describa los elementos básicos del Síndrome Demencial:

3. Describa los elementos básicos del Síndrome Demencial: EsunSindromeclínicoadquiridoyprogresivo caracterizadoporafectarlasfuncionesintelectuales superiores Deteriorodela memoria Presenciadeporlomenosunodelosiguientes déficits cognitivo enelcortoylargoplazo

Más detalles

SISTEMA NERVIOSO HUMANO

SISTEMA NERVIOSO HUMANO SISTEMA NERVIOSO HUMANO RETRASO MOTOR-MENTAL CEFALEAS. MIGRAÑAS MININGITIS LEUCOMALACIA PERIVENTRICULAR Reblandecimiento de la sustancia blanca EPILEPSIA La epilepsia está provocada por anormalidades en

Más detalles

ENFERMEDADES DE LAS MOTONEURONA SUPERIOR E INFERIOR

ENFERMEDADES DE LAS MOTONEURONA SUPERIOR E INFERIOR ENFERMEDADES DE LAS MOTONEURONA SUPERIOR E INFERIOR Introducción 1ª MOTONEURONA (Motoneurona Superior); se encuentran en la CORTEZA CEREBRAL y envían axones que forman la vía piramidal. Descienden hasta

Más detalles

Centro Psicológico Gran Vía ALZHEIMER. Definición. Síntomas

Centro Psicológico Gran Vía ALZHEIMER. Definición. Síntomas ALZHEIMER Definición Se trata de una alteración neurodegenerativa que afecta a las áreas relacionadas con el aprendizaje, la memoria, el pensamiento y ciertas actividades conductuales (dificultad para

Más detalles

SÍNTOMAS DE ALARMA. Dificultades para realizar tareas habituales. Desorientación en tiempo y espacio. Pérdida de la memoria. Problemas de Lenguaje

SÍNTOMAS DE ALARMA. Dificultades para realizar tareas habituales. Desorientación en tiempo y espacio. Pérdida de la memoria. Problemas de Lenguaje MAL DE ALZHEIMER 1 DEFINICIÓN La Enfermedad de Alzheimer, la causa más frecuente de demencia en los ancianos, es un trastorno grave, degenerativo, producido por la pérdida gradual de neuronas cerebrales,

Más detalles

Criterios para el diagnóstico clínico de la demencia frontotemporal

Criterios para el diagnóstico clínico de la demencia frontotemporal Anexo 1.10. Criterios para el diagnóstico clínico de la DLFT, demencia semántica y afasia progresiva no fluente, 51 traducido por la guía de la SEN, 2009 6,52 Criterios para el diagnóstico clínico de la

Más detalles

Enfermedad de Parkinson

Enfermedad de Parkinson CONCEPTO: El PARKINSON es un proceso degenerativo del sistema nervioso central, de instalación lenta, progresiva, que resulta de lesiones del sistema extrapiramidal (en el cerebro), generalmente de causa

Más detalles

Obstructivos o isquémicos:

Obstructivos o isquémicos: Daño cerebral Índice del tema Concepto de daño cerebral. Accidentes cerebrovasculares (ACV). Tipos. Sintomatología en función de la región dañada. Traumatismos craneoencefálicos (TCE). Definición. Grados

Más detalles

1 Trabajo fin de Master ANEXOS

1 Trabajo fin de Master ANEXOS 1 Trabajo fin de Master ANEXOS 2 Trabajo fin de Master ANEXO 1 3 Trabajo fin de Master LA COORDINACIÓN Y RELACIÓN EN LOS SERES VIVOS. EL SISTEMA NERVIOSO. 1.- LA COORDINACIÓN Y RELACIÓN EN LOS SERES VIVOS

Más detalles

TEMA: ALTERACIONES DEL MOVIMIENTO OCASIONADOS POR TRASTORNOS PROGRESIVOS DEL DOMINIO NEUROMUSCULAR

TEMA: ALTERACIONES DEL MOVIMIENTO OCASIONADOS POR TRASTORNOS PROGRESIVOS DEL DOMINIO NEUROMUSCULAR TEMA: ALTERACIONES DEL MOVIMIENTO OCASIONADOS POR TRASTORNOS PROGRESIVOS DEL DOMINIO NEUROMUSCULAR SUBTEMA 1: ALTERACIÓN DEL DESARROLLO NEUROMOTOR (PATRÓN B) INTRODUCCIÓN Las Alteraciones del desarrollo

Más detalles

Pasado, presente y futuro de la Enfermedad de

Pasado, presente y futuro de la Enfermedad de 5 de abril de 2016 VI ESCUELA DE FAMILIAS Pasado, presente y futuro de la Enfermedad de Dr. Javier Gay Puente Neurólogo CRE Alzheimer Alzheimer Francfort, noviembre de 1901 Institución para Enfermos Mentales

Más detalles

Trastornos Neurocognitivos

Trastornos Neurocognitivos Trastornos Neurocognitivos Dr. A. Alejandro Zavala Reina ISSSTE HR Lic. Adolfo López Mateos Hospital Médica Sur Definiciones Demencias: del latín de: "alejado" y mens "mente" Síndrome: Deterioro de la

Más detalles

NEUROPROTECCIÓN EN ESCLEROSIS MÚLTIPLE: UNA ESTRATEGIA A FUTURO?

NEUROPROTECCIÓN EN ESCLEROSIS MÚLTIPLE: UNA ESTRATEGIA A FUTURO? NEUROPROTECCIÓN EN ESCLEROSIS MÚLTIPLE: UNA ESTRATEGIA A FUTURO? Por Vladimiro Sinay Encargado del Área de Enfermedades Desmielinizantes. Instituto de Neurociencias de Fundación Favaloro. Durante años

Más detalles

Los criterios de diagnósticos de Demencia según DSM III R son:

Los criterios de diagnósticos de Demencia según DSM III R son: LA ENFERMEDAD DE ALZHEIMER Asignatura: Enfermería Psiquiátrica Curso: 2º (1.998/99) Grupo: T 2 Fecha: 30 de Abril de 1.999 UNIVERSITAT DE BARCELONA DIVISIÓ DE CIÈNCIES DE LA SALUT ESCOLA D'INFERMERIA CAMPUS

Más detalles

Ictus. Un problema que vamos a tratar. La segunda causa de muerte y la primera de discapacidad* * Según la OMS (Organización Mundial de la Salud)

Ictus. Un problema que vamos a tratar. La segunda causa de muerte y la primera de discapacidad* * Según la OMS (Organización Mundial de la Salud) Ictus La segunda causa de muerte y la primera de discapacidad* Un problema que vamos a tratar * Según la OMS (Organización Mundial de la Salud) El cerebro y las funciones neurológicas El cerebro es el

Más detalles

Deterioro cognitivo y Enfermedad de Alzheimer en pacientes con Síndrome de Down

Deterioro cognitivo y Enfermedad de Alzheimer en pacientes con Síndrome de Down MÁSTER EN AVANCES EN RADIOLOGÍA DIAGNÓSTICA Y TERAPÉUTICA Y MEDICINA FÍSICA, IX EDICIÓN UNIVERSIDAD DE GRANADA Deterioro cognitivo y Enfermedad de Alzheimer en pacientes con Síndrome de Down ALUMNA: Rocío

Más detalles

LA ENFERMEDAD ALCOHOLICA DR. ARSENIO ROSADO FRANCO. PRIMAVERA 2011

LA ENFERMEDAD ALCOHOLICA DR. ARSENIO ROSADO FRANCO. PRIMAVERA 2011 LA ENFERMEDAD ALCOHOLICA DR. ARSENIO ROSADO FRANCO. PRIMAVERA 2011 HISTORIA DE LA ENFERMEDAD LLAMADA ALCOHOLISMO 1952: DSM I ADICCION AL ALCOHOL 1952-1960 JELLINECK PUBLICO TRABAJOS CONCEPTUALIZANDO AL

Más detalles

Obesidad y sus complicaciones

Obesidad y sus complicaciones Obesidad y sus complicaciones 0123/#$4#(-#%,%#5/&()+)$,/*,/&6#5)%,%7/012)3$#5/8)#$#$/ -,9&(/()#5+&7/0:2;*#5/5&$/*,5/'&$5#'2#$'),57/ INTRODUCCIÓN La obesidad es por sí misma un problema de salud. Antes

Más detalles

ALZHEIMER Y OTRAS DEMENCIAS

ALZHEIMER Y OTRAS DEMENCIAS ALZHEIMER Y OTRAS DEMENCIAS Virginia Silva Zavaleta, Neuropsicóloga Directora del Programa de Intervención Pacientes (IPA) en AFALcontigo QUÉ ES LA ENFERMEDAD DE ALZHEIMER?. Es una demencia neurodegenerativa,

Más detalles

SISTEMA NERVIOSO. 1. Dibujo (señalando las partes) 2. Partes:

SISTEMA NERVIOSO. 1. Dibujo (señalando las partes) 2. Partes: SISTEMA NERVIOSO 1. Dibujo (señalando las partes) 2. Partes: - Cerebro: Es la parte más grande del sistema nervioso y se divide en dos hemisferios, derecho e izquierdo. Está protegida por el cráneo. -

Más detalles

MAL DE ALZHEIMER I. Dr. Juan Moises de la Serna

MAL DE ALZHEIMER I. Dr. Juan Moises de la Serna MAL DE ALZHEIMER I QUÉ ES? CUÁLES SON SUS CAUSAS? QUÉ CONSECUENCIAS CONLLEVA? DR. JUAN MOISÉS DE LA SERNA juanmoisesdelaserna.es Copyright 2015 INTRODUCCIÓN MAL DE ALZHEIMER I El objetivo del libro es

Más detalles

Práctica 6 ATENCIÓN EDUCATIVA A ALUMNOS CON DÉISCAPACIDAD PSÍQUICA ASOCIADA A RETRASO MENTAL

Práctica 6 ATENCIÓN EDUCATIVA A ALUMNOS CON DÉISCAPACIDAD PSÍQUICA ASOCIADA A RETRASO MENTAL Práctica 6 ATENCIÓN EDUCATIVA A ALUMNOS CON DÉISCAPACIDAD PSÍQUICA ASOCIADA A RETRASO MENTAL Los alumnos con retraso mental, son alumnos que presentan neae. En esta, como en muchas otras casuísticas, la

Más detalles

Síntomas Psicológicos y Conductuales como Factores de Progresión a Demencia Tipo Alzheimer en el Deterioro Cognitivo Leve

Síntomas Psicológicos y Conductuales como Factores de Progresión a Demencia Tipo Alzheimer en el Deterioro Cognitivo Leve Síntomas Psicológicos y Conductuales como Factores de Progresión a Demencia Tipo Alzheimer en El Deterioro Cognitivo Leve (DCL), se considera por muchos especialistas, un estado prodrómico entre el deterioro

Más detalles

Actualización en Deterioro Cognitivo Leve. Dr. Rubén Alvarado Especialista en Geriatría

Actualización en Deterioro Cognitivo Leve. Dr. Rubén Alvarado Especialista en Geriatría Actualización en Deterioro Cognitivo Leve Dr. Rubén Alvarado Especialista en Geriatría Criterios diagnósticos Deterioro Cognitivo Leve (DCL)! Se observa un cambio en función cognitiva por parte de un informante

Más detalles

Test demencias 10 UNA SERIE DE ACCIDENTES VASCULARES AGUDOS O POR UN ÚNICO ATAQUE DE APOPLEJÍA? - 1

Test demencias 10 UNA SERIE DE ACCIDENTES VASCULARES AGUDOS O POR UN ÚNICO ATAQUE DE APOPLEJÍA? - 1 1) UNO DE LOS SÍNTOMAS DE LA DEPRESIÓN, SON LAS IDEAS DE PESIMISMO, RUINA Y CULPABILIDAD. DICHOS SÍNTOMAS SON: a) Alteraciones afectivas o emocionales b) Alteraciones del pensamiento c) Alteraciones de

Más detalles

PATOLOGÍAS TUMORES. Tumores de neuronas:

PATOLOGÍAS TUMORES. Tumores de neuronas: PATOLOGÍAS TUMORES Cuando se consideran los tumores del sistema nervioso no debe olvidarse que este sistema está formado por muchos tipos diferentes de tejidos, neuronas, neurolgia, vasos sanguíneos y

Más detalles

MASTER EN NEUROCIENCIA

MASTER EN NEUROCIENCIA Titulación: MÁSTER EN NEUROCIENCIA POR LA UCM. Nombre de la materia: Enfermedades degenerativas (enfoque clínico y molecular) Semestre: 2º cuatrimestre (curso 2014-2015) Módulo: Neurociencia Clínica Tipo:

Más detalles

Entendiendo la Enfermedad de Alzheimer. No Es Simple Olvido. Alzheimer s Disease Research

Entendiendo la Enfermedad de Alzheimer. No Es Simple Olvido. Alzheimer s Disease Research No Es Simple Olvido Alzheimer s Disease Research 2 La enfermedad de Alzheimer afecta la memoria, pero implica mucho más que simple olvido. Es un trastorno progresivo, degenerativo e incurable del cerebro

Más detalles

A protective factor for the ageing brain. Nature

A protective factor for the ageing brain. Nature A protective factor for the ageing brain. Nature Tsai, L.-H. & Madabhushi, R. Beatriz García Santa Cruz Existen mecanismos que contribuyen a la neuroprotección durante los procesos de envejecimiento. En

Más detalles

Amiloide βa4, taupatías, alfa-sinucleinopatías y prionopatías

Amiloide βa4, taupatías, alfa-sinucleinopatías y prionopatías ARTÍCULO DE REVISIÓN Amiloide βa4, taupatías, alfa-sinucleinopatías y prionopatías Isidro Ferrer Unidad de Neuropatología. Servicio de Anatomía Patológica. Hospital Príncipes de España. Universidad de

Más detalles

Comisión Nacional del Mercado de Valores Att. Director del Área de Mercados C/ Miguel Ángel 11, 1º 28010 Madrid

Comisión Nacional del Mercado de Valores Att. Director del Área de Mercados C/ Miguel Ángel 11, 1º 28010 Madrid José Abascal, 2 1ª Tel.: 34 91 444 45 00 Fax.: 34 91 593 29 54 28003 MADRID Comisión Nacional del Mercado de Valores Att. Director del Área de Mercados C/ Miguel Ángel 11, 1º 28010 Madrid Madrid, a 27

Más detalles

DIABETES: DULCE ENEMIGO

DIABETES: DULCE ENEMIGO DIABETES: DULCE ENEMIGO La diabetes está alcanzando proporciones epidémicas. Los expertos atribuyen la causa de la epidemia a nuestro estilo de vida sedentario, la mala alimentación y la obesidad. La diabetes

Más detalles

Conocer la esclerosis múltiple

Conocer la esclerosis múltiple DEPARTAMENTO DE RECURSOS HUMANOS Conocer la esclerosis múltiple ES UNA ENFERMEDAD QUE AFECTA AL SISTEMA NERVIOSO CENTRAL Y CUYA EVOLUCION ES IMPREDECIBLE Y VARIABLE. ESTAS CARACTERISTICAS, ENTRE OTRAS,

Más detalles

La mala memoria. Cómo mantener su memoria aguda

La mala memoria. Cómo mantener su memoria aguda La mala memoria María ha sido una maestra por 35 años. Enseñar llena su vida y la hace sentirse realizada, pero recientemente ella ha empezado a olvidar detalles y se ha hecho más y más desorganizada.

Más detalles

5. TENIASIS Y CISTICERCOSIS HUMANA

5. TENIASIS Y CISTICERCOSIS HUMANA 5. TENIASIS Y CISTICERCOSIS HUMANA 5.1 Patología de la neurocisticercosis La neurocisticercosis se produce cuando la larva de la T. s. invade el sistema nerviosos central. La causa de los diferentes síntomas

Más detalles

Trastorno Depresivo Mayor D R A. M A R Í A Y O L D I N E G R E T E

Trastorno Depresivo Mayor D R A. M A R Í A Y O L D I N E G R E T E Trastorno Depresivo Mayor D R A. M A R Í A Y O L D I N E G R E T E TDM Forma parte de los Trastornos del Estado de Ánimo Tienen como característica principal una alteración del humor También es llamada

Más detalles

ATENEO DE POLICLINICA. 19/07/2012 Dr. Andrés Lescano

ATENEO DE POLICLINICA. 19/07/2012 Dr. Andrés Lescano ATENEO DE POLICLINICA 19/07/2012 Dr. Andrés Lescano Historia Clínica Paciente 45 años, procedente de Montevideo, taximetrista actualmente sin trabajo, diestro, secundaria incompleta, sin APP a destacar.

Más detalles

Diagnóstico precoz y diferencial en demencia tipo Alzheimer

Diagnóstico precoz y diferencial en demencia tipo Alzheimer Congresos Medwave. Año IX, No. 7, Julio 2009. Open Access, Creative Commons. Diagnóstico precoz y diferencial en demencia tipo Alzheimer Autor: Gustav Rohde Calderón (1) Filiación: (1) Universidad de Valparaíso,

Más detalles

Demencias 2ª parte. CENTRO DE ESTUDIOS RIVAS & MÉNGAR MAGNUS BLIKSTAD 83 ENTRLO C 985359678 www.academiamengar.es Correo: academiamengar@gmail.

Demencias 2ª parte. CENTRO DE ESTUDIOS RIVAS & MÉNGAR MAGNUS BLIKSTAD 83 ENTRLO C 985359678 www.academiamengar.es Correo: academiamengar@gmail. 1) CUÁL DE LOS SIGUIENTES NO SE CONSIDERA FACTOR DE RIESGO EN LA DEMENCIA VASCULAR? a) La hipertensión arterial. b) La enfermedad pulmonar. c) El tabaquismo. 2) CUÁL DE LAS SIGUIENTES PATOLOGÍAS NO SE

Más detalles

La enfermedad de Alzheimer y otras demencias

La enfermedad de Alzheimer y otras demencias Capítulo de Illinois La enfermedad de Alzheimer y otras demencias Acerca de la demencia Esta hoja de datos trata brevemente sobre el Alzheimer y algunas de otras demencias. La palabra «demencia» es un

Más detalles

UNIVERSIDAD DE SALAMANCA TRABAJO FIN DE MÁSTER

UNIVERSIDAD DE SALAMANCA TRABAJO FIN DE MÁSTER UNIVERSIDAD DE SALAMANCA MÁSTER UNIVERSITARIO EN INTERVENCIÓN A PERSONAS CON ENFERMEDAD DE ALZHEIMER TRABAJO FIN DE MÁSTER ALTERACIONES DEL LCR EN EL DIAGNÓSTICO PRESINTOMÁTICO DE LA ENFERMEDAD DE ALZHEIMER

Más detalles

II- Qué es la Diabetes?

II- Qué es la Diabetes? I - Introducción La Diabetes Mellitus es una enfermedad considerada como un problema de salud pública. Su prevalencia ha ido en aumento y las proyecciones en este milenio son de proporciones substanciales,

Más detalles

Qué es la logopedia?

Qué es la logopedia? Qué es la logopedia? La palabra logopedia está compuesta por dos términos de origen griego: logos, que significa palabra, verbo, habla, lenguaje o discurso y paideia que significa educación de los niños.

Más detalles

Definición de Alzheimer

Definición de Alzheimer TEMA 2 Definición de Alzheimer Juana Torralbo Jurado y Ana Belén García Lozano 1. definición La enfermedad de Alzheimer (EA) es la forma más común en ancianos de demencia, cuya causa no es del todo conocida.

Más detalles

Cátedra de BIOLOGÍA DEL COMPORTAMIENTO Profesor Asociado Regular Dr. Rubén N. Muzio. - Material complementario -

Cátedra de BIOLOGÍA DEL COMPORTAMIENTO Profesor Asociado Regular Dr. Rubén N. Muzio. - Material complementario - Universidad de Buenos Aires Facultad de Psicología Cátedra de BIOLOGÍA DEL COMPORTAMIENTO Profesor Asociado Regular Dr. Rubén N. Muzio ESQUIZOFRENIA Y ALZHEIMER - Material complementario - Dr. Rubén N.

Más detalles

TEMA 23- LAS DEMENCIAS.

TEMA 23- LAS DEMENCIAS. - LAS DEMENCIAS. 1.- CONCEPTO DE DEMENCIA. 1.1.- GENERALIDADES. A comienzos del siglo XX se consideraba la demencia como un proceso de deterioro patológico de la inteligencia, inexorable e irreversible,

Más detalles

Caracterización de la enfermedad de Alzheimer en Nicaragua mediante parámetros clínicos, moleculares y de imagen 1

Caracterización de la enfermedad de Alzheimer en Nicaragua mediante parámetros clínicos, moleculares y de imagen 1 Caracterización de la enfermedad de Alzheimer en Nicaragua mediante parámetros clínicos, moleculares y de imagen 1 Eddy Zepeda Fundación Alzheimer de Nicaragua, miembro de la Academia de Ciencias de Nicaragua

Más detalles

HEPATOPATÍAS MITOCONDRIALES

HEPATOPATÍAS MITOCONDRIALES HEPATOPATÍAS MITOCONDRIALES Qué es la enfermedad hepática mitocondrial? Las "mitocondrias" son pequeñas plantas de energía dentro de cada célula de nuestro cuerpo. Les suministran a la célula con energía

Más detalles

Hospital General de Agudos E. Tornú ORL Fonoaudiología

Hospital General de Agudos E. Tornú ORL Fonoaudiología Hospital General de Agudos E. Tornú ORL Fonoaudiología Neuropsicología a Aplicada Baterías as neuropsicológicas Lic. Liliana Arjona Neuropsicología Es la ciencia que estudia las Funciones Superiores en

Más detalles

Jornada sobre la malaltia de Huntington i demències degeneratives d inici precoç. Organització assistencial i línies d investigació

Jornada sobre la malaltia de Huntington i demències degeneratives d inici precoç. Organització assistencial i línies d investigació Jornada sobre la malaltia de Huntington i demències degeneratives d inici precoç. Organització assistencial i línies d investigació Consejo genético en demencias degenerativas de inicio precoz Dra Raquel

Más detalles

FUNDAMENTOS BIOLÓGICOS DEL APRENDIZAJE Y LA MEMORIA

FUNDAMENTOS BIOLÓGICOS DEL APRENDIZAJE Y LA MEMORIA Departamento de Biología Ambiental y Salud Pública FUNDAMENTOS BIOLÓGICOS DEL APRENDIZAJE Y LA MEMORIA INTRODUCCIÓN. Genes y ambiente. Las cualidades heredadas y los efectos de la experiencia. El sustrato

Más detalles

Grupo blanco. Cápsula médica XII Alzheimer

Grupo blanco. Cápsula médica XII Alzheimer Grupo blanco. Cápsula médica XII Alzheimer Es una enfermedad crónico-degenerativa del sistema nervioso central (SNC) en la cual se pierden las funciones mentales más avanzadas (memoria, capacidad de juicio

Más detalles

Atención de enfermería ante el alzhéimer. Autor: María Povedano Jiménez

Atención de enfermería ante el alzhéimer. Autor: María Povedano Jiménez Atención de enfermería ante el alzhéimer Autor: María Povedano Jiménez Índice 1. Qué es el alzhéimer?... 4 2. Historia... 5 3. Epidemiología... 8 4. Etiología... 9 5. Patogenia... 13 Neuropatología...

Más detalles

Enfermedad de Alzheimer

Enfermedad de Alzheimer Puesta al día Enfermedad de Alzheimer La Enfermedad de Alzheimer es la forma más común de demencia en las personas mayores. Es una enfermedad neurodegenerativa, irreversible, que afecta progresivamente

Más detalles

Alberto Plaza Psicólogo Profesor Colaborador UPUA 1

Alberto Plaza Psicólogo Profesor Colaborador UPUA 1 Alberto Plaza Psicólogo Profesor Colaborador UPUA 1 Necesidades generadas: Crear habilidades y recursos que facilitan un envejecimiento saludable y satisfactorio que produzca calidad de vida en los mayores

Más detalles

Zaintzea Senide zaintzaileei laguntzeko udal zentroa Centro municipal de apoyo a familiares cuidadores

Zaintzea Senide zaintzaileei laguntzeko udal zentroa Centro municipal de apoyo a familiares cuidadores Una parte importante de las personas mayores presenta algún tipo de problema de salud, siendo alguno de los más frecuentes aquellos que afectan principalmente al funcionamiento físico, psicológico y social,

Más detalles

TIF: CUCCARESE MONICA. Fragilidad y vulnerabilidad del adulto mayor

TIF: CUCCARESE MONICA. Fragilidad y vulnerabilidad del adulto mayor TIF: CUCCARESE MONICA Fragilidad y vulnerabilidad del adulto mayor 06/09/2015 Q ue factores de vulnerabilidad pudieron identificar en la población destinatarios? Si entendemos por fragilidad implica la

Más detalles

ALZHEIMER, PARKINSON Y ESCLEROSIS MÚLTIPLE

ALZHEIMER, PARKINSON Y ESCLEROSIS MÚLTIPLE SEGUIMIENTO NUTRICIONAL EN DIFERENTES PATOLOGÍAS ALTERACIONES NUTRICIONALES EN OTRAS PATOLOGÍAS ENFERMEDADES NEUROLÓGICAS: ALZHEIMER, PARKINSON Y ESCLEROSIS MÚLTIPLE Mª Soledad Fernández Pachón Profesora

Más detalles

Nilton Custodio Rosa Montesinos

Nilton Custodio Rosa Montesinos Enfermedad de Alzheimer Conociendo a la enfermedad, que llegó para quedarse Autores Nilton Custodio Rosa Montesinos Abril 2015 PRÓLOGO La probabilidad de desarrollar demencia y enfermedad de Alzheimer

Más detalles

ACTUALIZACIÓN DE LA CODIFICACIÓN DEL DSM-5

ACTUALIZACIÓN DE LA CODIFICACIÓN DEL DSM-5 DSM-5 ACTUALIZACIÓN DE LA CODIFICACIÓN DEL DSM-5 Suplemento del MANUAL DIAGNÓSTICO Y ESTADÍSTICO DE TRASTORNOS MENTALES, QUINTA EDICIÓN Asociación Americana de Psiquiatría Marzo 2014 Actualización de la

Más detalles

El Mal de Alzheimer, una forma de demencia

El Mal de Alzheimer, una forma de demencia ENFERMEDADES Por Gabriel Alvarez El Mal de Alzheimer, una forma de demencia (1ra. parte) Como reflejo de las mejoras en las condiciones sociales y sanitarias, la población de ancianos crece rápidamente,

Más detalles